Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


AA Sequence

SGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQRCSQ                                      771 - 806

Text Mined References (1)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.