Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VT03 A6NGV9
Symbols FAM22D

Gene

 Compartment GO Term (0)

AA Sequence

MFQEPVYFQIFLFQLDSGASGEPGHSLGLTLGFSHCGNCQTAVVSAQPEGMASNGAYPALGPGVTANPGT      1 - 70
SLSVFTALPFTTPAPGPAHGPLLVTAGAPPGGPLVLSNFPSTPLVTEQDGCGPSGAGASNVFVQMRTEVG     71 - 140
PVKAAQAQTLVLTQTPLVWQAPGALCGGVVCPPPLLLAAAPVVPVMAAQVVGGTQACEGGWSQGLPLPPP    141 - 210
PPPAAQLPPIVSQGNAGPWPQGAHGEGSLASSQAKAPPDDSCNPRSVYENFRLWQHYKPLARRHLPQSPD    211 - 280
TEALSCFLIPVLRSLARRKPTMTLEEGLWRAMREWQHTSNFDRMIFYEMAEKFLEFEAEEEMQIQKSQWM    281 - 350
KGPQCLPPPATPRLEPRGPPAPEVVKQPVYLPSKAGPKAPTACLPPPRPQRPVTKARRPPPRPHRRAETK    351 - 420
ARLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGPSLGATGEPEKQREEGEVKQPQEEDWTPPDPGL    421 - 490
LSYTDKLCSQKDFVTKVEAVIHPQFLEELLSPDPQMDFLALSQELEQEEGLTLAQLVEKRLLPLKEKQHA    491 - 560
RAAPSRGTARLDSSSSKFAAGQGAERDVPDPQQGVGMETCPPQTTARDSQGRGRAHTGMARSKDSVVLLG    561 - 630
CQDSPGLRAARPTSPPQDHRPTCPGVGTKDALDLPGGSPVRESHGLAQGSSEEEELPSLAFLLGSQHKLL    631 - 700
PWWLPQSPVPASGLLSPEKWGPQGTHQSPSAERRGLNLAPSPANKAKKRPLFGSLSPAEKTPHPGPGLRV    701 - 770
SGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQRCSQ                                      771 - 806
//

Text Mined References (1)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.