Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.61
PubTator Score 1.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ -1.200 3.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 2.1e-03
non-small cell lung cancer -1.041 1.2e-14
osteosarcoma -2.422 1.2e-02
ovarian cancer -1.700 1.4e-06
tuberculosis -1.100 1.3e-03

Gene RIF (1)

AA Sequence

MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA      1 - 70
NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE     71 - 140
YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFF    141 - 210
NRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWE    211 - 280
AKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKY    281 - 350
QGGRKGKRNSESDQCR                                                          351 - 366
//

Text Mined References (14)

PMID Year Title