Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.61
PubTator Score 1.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.63430642572509E-20
ovarian cancer 8492 1.37796813690678E-7
tuberculosis and treatment for 3 months 327 2.6630244584364E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00211594770732596
ductal carcinoma in situ 1745 0.00303739230434216
osteosarcoma 7933 0.0115548988819828
Disease Target Count Z-score Confidence
Nonepidermolytic palmoplantar keratoderma 12 4.636 2.3

Expression

  Differential Expression (6)

Synonym

Accession Q5VSY0 Q96LI0 Q9BYI1 Q9BYI2 Q9H225
Symbols FKSG21
GKAP42

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Gene RIF (1)

PMID Text
10671526 This paper describes the protein interaction, expression, localization and function of a highly similar gene in mouse.

AA Sequence

MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA      1 - 70
NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE     71 - 140
YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFF    141 - 210
NRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWE    211 - 280
AKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKY    281 - 350
QGGRKGKRNSESDQCR                                                          351 - 366
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16015647 2005 Delineation of the minimal commonly deleted segment and identification of candidate tumor-suppressor genes in del(9q) acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...