Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.100 7.6e-03
Breast cancer 2.900 4.6e-02
chronic lymphosyte leukemia -1.100 1.7e-06
group 4 medulloblastoma 1.400 9.8e-03
malignant mesothelioma 1.100 9.0e-05
medulloblastoma, large-cell 1.100 2.7e-04
osteosarcoma 2.171 9.7e-06
subependymal giant cell astrocytoma -1.719 2.9e-02

Synonym

Accession Q5VST6 A8KAJ5 Q5VST7 Q86YB6 Q8IY03 Q9Y377
Symbols CGI-67
C9orf77
FAM108B1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFM      1 - 70
TRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEK     71 - 140
NLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYC    141 - 210
FDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQF    211 - 280
VSQELVNL                                                                  281 - 288
//

Text Mined References (8)

PMID Year Title