Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
chronic lymphosyte leukemia 232 1.66155342674542E-6
osteosarcoma 7933 9.73368737719121E-6
malignant mesothelioma 3163 9.02059350278796E-5
medulloblastoma, large-cell 6234 2.67485983462687E-4
astrocytoma 1493 0.00763258605168615
group 4 medulloblastoma 1875 0.00976387605899044
subependymal giant cell astrocytoma 2287 0.0287457988483552
Breast cancer 3099 0.0460366230389745

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma 2.171 0.000
chronic lymphosyte leukemia -1.100 0.000
astrocytoma -1.100 0.008
medulloblastoma, large-cell 1.100 0.000
Breast cancer 2.900 0.046
group 4 medulloblastoma 1.400 0.010
subependymal giant cell astrocytoma -1.719 0.029

Synonym

Accession Q5VST6 A8KAJ5 Q5VST7 Q86YB6 Q8IY03 Q9Y377
Symbols CGI-67
C9orf77
FAM108B1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

AA Sequence

MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFM      1 - 70
TRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEK     71 - 140
NLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYC    141 - 210
FDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQF    211 - 280
VSQELVNL                                                                  281 - 288
//

Text Mined References (7)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.