Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.66
PubTator Score 0.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.253 2.9e-03
atypical teratoid / rhabdoid tumor -1.300 2.1e-03
Breast cancer 1.100 1.1e-04
ductal carcinoma in situ 1.700 9.3e-03
group 3 medulloblastoma 1.400 1.7e-05
invasive ductal carcinoma 1.600 1.3e-02
lung adenocarcinoma 1.800 1.9e-08
lung carcinoma 2.300 4.8e-48
ovarian cancer 1.200 4.2e-05
pituitary cancer 1.300 2.1e-05

Gene RIF (1)

AA Sequence

MARRRRRACIALFLVLLFAFGTLMGLRTLKAPDGLPALGPGLELAPFERRPEGAPAPAARAPAAPAAPPP      1 - 70
PPPPPRTADPGGSPGPAPAEAEPAPVQSLRVYSDLHAFYYSWYGSPRREGHYIHWDHVMVPHWDPKISAS     71 - 140
YPRGRHSPPDDLGSSFYPELGPYSSRDPEVLREHMTQLKEAAIGVLVLSWYPPGMADDNGEPSDDLVPAI    141 - 210
LDTAHQYSIQVAFHIQPYKGRDDITVHDNIKYIIDTYGSHGAFYRYKNSMGKSLPLFYIYDSYLTSPEAW    211 - 280
AHLLTPNGPHSIRNTPYDGVFIALLVEEGHTHDILAAGFDGMYTYFASNGFSFGSSHQNWKAVKNFCDAN    281 - 350
NLMFIPSVGPGYIDTSIRPWNNHNTRNRVNGKYYETALQAALTVRPEIVSITSFNEWHEGTQIEKAIPKK    351 - 420
TPTRLYLDYLPHQPSLYLELTRRWAEHFIKEKEQWLM                                     421 - 457
//

Text Mined References (5)

PMID Year Title