Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.16
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.75591343851238E-48
lung adenocarcinoma 2714 1.86921627934981E-8
group 3 medulloblastoma 2254 1.70866617293318E-5
pituitary cancer 1972 2.06827084541403E-5
ovarian cancer 8492 4.24519337664038E-5
Breast cancer 3099 1.05259626864685E-4
atypical teratoid / rhabdoid tumor 4369 0.00208783610540576
adrenocortical carcinoma 1427 0.00291099913694375
ductal carcinoma in situ 1745 0.00929643156467016
invasive ductal carcinoma 2950 0.0125449693236489
Disease Target Count Z-score Confidence
Duodenum cancer 1 3.653 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.002
adrenocortical carcinoma 1.253 0.003
group 3 medulloblastoma 1.400 0.000
lung adenocarcinoma 1.800 0.000
lung carcinoma 2.300 0.000
Breast cancer 1.100 0.000
ductal carcinoma in situ 1.700 0.009
invasive ductal carcinoma 1.600 0.013
ovarian cancer 1.200 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q5VSG8 Q6DD86 Q6P497 Q8N5P8 Q96G55 Q96N42
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MARRRRRACIALFLVLLFAFGTLMGLRTLKAPDGLPALGPGLELAPFERRPEGAPAPAARAPAAPAAPPP      1 - 70
PPPPPRTADPGGSPGPAPAEAEPAPVQSLRVYSDLHAFYYSWYGSPRREGHYIHWDHVMVPHWDPKISAS     71 - 140
YPRGRHSPPDDLGSSFYPELGPYSSRDPEVLREHMTQLKEAAIGVLVLSWYPPGMADDNGEPSDDLVPAI    141 - 210
LDTAHQYSIQVAFHIQPYKGRDDITVHDNIKYIIDTYGSHGAFYRYKNSMGKSLPLFYIYDSYLTSPEAW    211 - 280
AHLLTPNGPHSIRNTPYDGVFIALLVEEGHTHDILAAGFDGMYTYFASNGFSFGSSHQNWKAVKNFCDAN    281 - 350
NLMFIPSVGPGYIDTSIRPWNNHNTRNRVNGKYYETALQAALTVRPEIVSITSFNEWHEGTQIEKAIPKK    351 - 420
TPTRLYLDYLPHQPSLYLELTRRWAEHFIKEKEQWLM                                     421 - 457
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.