Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 10
Funding $1,132,522.5
PubMed Score 15.19
PubTator Score 7.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26206078 An epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci (FAM72A, FAM72B, FAM72C, FAM72D).
23900679 Data indicate that p17 (p17 amyloid-beta peptide-induced protein; known as Ugene, LMPIP, or FAM72A/B) drives the cell cycle into the G0/G1 phase and enhances survival of proliferating cells.
21317926 It was found that Ugene, designated herein as LMP1-induced protein (LMPIP), was induced, in a time-dependent manner, in EBV-infected peripheral blood mononuclear cells and LMP1-transfected 293 cells.
19755123 this study provides an additional possible mechanism of neurotoxicity in Alzheimer's disease, the induction of p17(FAM72B), through which Abeta acts to induce apoptosis and exhibit other Alzheimer's disease characteristics.
18676834 Using deletion constructs, the authors find that Ugene binds to the first 25 amino acids of the UNG2 NH(2) terminus. They suggest that Ugene induction in cancer may contribute to the cancer phenotype by interacting with the BER pathway.

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLK      1 - 70
DIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVL     71 - 140
NISAEECIR                                                                 141 - 149
//

Text Mined References (11)

PMID Year Title
26206078 2015 All-or-(N)One - an epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci.
25416956 2014 A proteome-scale map of the human interactome network.
25234718 2015 Lead discovery and in silico 3D structure modeling of tumorigenic FAM72A (p17).
23900679 2013 The protein p17 signaling pathways in cancer.
21317926 2011 Functional interaction of Ugene and EBV infection mediates tumorigenic effects.
19755123 2009 Identification and characterisation of the novel amyloid-beta peptide-induced protein p17.
18676834 2008 Ugene, a newly identified protein that is commonly overexpressed in cancer and binds uracil DNA glycosylase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
More...