Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.96
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-02
astrocytic glioma -1.200 6.2e-03
chronic rhinosinusitis -1.279 9.6e-03
cystic fibrosis and chronic rhinosinusit... -1.166 4.2e-02
ependymoma 1.200 3.2e-05
glioblastoma -1.200 2.1e-02
group 3 medulloblastoma 1.300 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.200 6.2e-04
lung cancer 2.600 1.1e-03
nasopharyngeal carcinoma -1.800 1.9e-08
osteosarcoma -1.407 1.1e-02

Gene RIF (2)

AA Sequence

MNENKDTDSKKSEEYEDDFEKDLEWLINENEKSDASIIEMACEKEENINQDLKENETVMEHTKRHSDPDK      1 - 70
SLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRYIMEKIVQANKLLQN     71 - 140
QEPVNDKRERKLKFKDQLVDLEVPPLEDTTTFKNYFENERNMFGKLSQLCISNDFGQEDVLLSLTNGSCE    141 - 210
ENKDRTILVERDGKFELLNLQDIASQGFLPPINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVT    211 - 280
HSSTGEPLAYIAQPPLNRKTCPSSAVNSDRSKGNGKSNHRTQSAHISPVTSTYCLSPRQKELQKQLEEKR    281 - 350
EKLKREEERRKIEEEKEKKRENDIVFKAWLQKKREQVLEMRRIQRAKEIEDMNSRQENRDPQQAFRLWLK    351 - 420
KKHEEQMKERQTEELRKQEECLFFLKGTEGRERAFKQWLRRKRMEKMAEQQAVRERTRQLRLEAKRSKQL    421 - 490
QHHLYMSEAKPFRFTDHYN                                                       491 - 509
//

Text Mined References (8)

PMID Year Title