Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.29
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.177 2.5e-03
adult high grade glioma -1.900 3.0e-05
astrocytic glioma -1.300 1.2e-02
Astrocytoma, Pilocytic -1.300 1.1e-04
atypical teratoid / rhabdoid tumor -3.500 1.7e-11
cystic fibrosis -1.100 9.1e-04
ductal carcinoma in situ 2.400 2.0e-03
ependymoma -2.600 4.0e-02
glioblastoma -2.100 2.8e-06
group 3 medulloblastoma -3.500 6.4e-05
interstitial cystitis -2.500 3.1e-04
intraductal papillary-mucinous carcinoma... 1.600 9.2e-03
invasive ductal carcinoma 3.200 2.3e-03
lung adenocarcinoma -1.200 4.0e-09
lung carcinoma 1.800 2.2e-20
medulloblastoma, large-cell -3.800 1.4e-06
non-small cell lung cancer -1.388 3.6e-09
oligodendroglioma -1.100 1.5e-07
ovarian cancer -1.800 1.9e-06
Pick disease -1.400 1.1e-02
primitive neuroectodermal tumor -2.700 1.5e-04
psoriasis -1.400 3.6e-30
spina bifida -1.357 4.1e-02
subependymal giant cell astrocytoma -3.556 4.3e-02

Gene RIF (1)

AA Sequence

MEEILRKLQKEASGSKYKAIKESCTWALETLGGLDTIVKIPPHVLREKCLLPLQLALESKNVKLAQHALA      1 - 70
GMQKLLSEERFVSMETDSDEKQLLNQILNAVKVTPSLNEDLQVEVMKVLLCITYTPTFDLNGSAVLKIAE     71 - 140
VCIETYISSCHQRSINTAVRATLSQMLSDLTLQLRQRQENTIIENPDVPQDFGNQGSTVESLCDDVVSVL    141 - 210
TVLCEKLQAAINDSQQLQLLYLECILSVLSSSSSSMHLHRRFTDLIWKNLCPALIVILGNPIHDKTITSA    211 - 280
HTSSTSTSLESDSASPGVSDHGRGSGCSCTAPALSGPVARTIYYIAAELVRLVGSVDSMKPVLQSLYHRV    281 - 350
LLYPPPQHRVEAIKIMKEILGSPQRLCDLAGPSSTESESRKRSISKRKSHLDLLKLIMDGMTEACIKGGI    351 - 420
EACYAAVSCVCTLLGALDELSQGKGLSEGQVQLLLLRLEELKDGAEWSRDSMEINEADFRWQRRVLSSEH    421 - 490
TPWESGNERSLDISISVTTDTGQTTLEGELGQTTPEDHSGNHKNSLKSPAIPEGKETLSKVLETEAVDQP    491 - 560
DVVQRSHTVPYPDITNFLSVDCRTRSYGSRYSESNFSVDDQDLSRTEFDSCDQYSMAAEKDSGRSDVSDI    561 - 630
GSDNCSLADEEQTPRDCLGHRSLRTAALSLKLLKNQEADQHSARLFIQSLEGLLPRLLSLSNVEEVDTAL    631 - 700
QNFASTFCSGMMHSPGFDGNSSLSFQMLMNADSLYTAAHCALLLNLKLSHGDYYRKRPTLAPGVMKDFMK    701 - 770
QVQTSGVLMVFSQAWIEELYHQVLDRNMLGEAGYWGSPEDNSLPLITMLTDIDGLESSAIGGQLMASAAT    771 - 840
ESPFAQSRRIDDSTVAGVAFARYILVGCWKNLIDTLSTPLTGRMAGSSKGLAFILGAEGIKEQNQKERDA    841 - 910
ICMSLDGLRKAARLSCALGVAANCASALAQMAAASCVQEEKEEREAQEPSDAITQVKLKVEQKLEQIGKV    911 - 980
QGVWLHTAHVLCMEAILSVGLEMGSHNPDCWPHVFRVCEYVGTLEHNHFSDGASQPPLTISQPQKATGSA    981 - 1050
GLLGDPECEGSPPEHSPEQGRSLSTAPVVQPLSIQDLVREGSRGRASDFRGGSLMSGSSAAKVVLTLSTQ   1051 - 1120
ADRLFEDATDKLNLMALGGFLYQLKKASQSQLFHSVTDTVDYSLAMPGEVKSTQDRKSALHLFRLGNAML   1121 - 1190
RIVRSKARPLLHVMRCWSLVAPHLVEAACHKERHVSQKAVSFIHDILTEVLTDWNEPPHFHFNEALFRPF   1191 - 1260
ERIMQLELCDEDVQDQVVTSIGELVEVCSTQIQSGWRPLFSALETVHGGNKSEMKEYLVGDYSMGKGQAP   1261 - 1330
VFDVFEAFLNTDNIQVFANAATSYIMCLMKFVKGLGEVDCKEIGDCAPAPGAPSTDLCLPALDYLRRCSQ   1331 - 1400
LLAKIYKMPLKPIFLSGRLAGLPRRLQEQSASSEDGIESVLSDFDDDTGLIEVWIILLEQLTAAVSNCPR   1401 - 1470
QHQPPTLDLLFELLRDVTKTPGPGFGIYAVVHLLLPVMSVWLRRSHKDHSYWDMASANFKHAIGLSCELV   1471 - 1540
VEHIQSFLHSDIRYESMINTMLKDLFELLVACVAKPTETISRVGCSCIRYVLVTAGPVFTEEMWRLACCA   1541 - 1610
LQDAFSATLKPVKDLLGCFHSGTESFSGEGCQVRVAAPSSSPSAEAEYWRIRAMAQQVFMLDTQCSPKTP   1611 - 1680
NNFDHAQSCQLIIELPPDEKPNGHTKKSVSFREIVVSLLSHQVLLQNLYDILLEEFVKGPSPGEEKTIQV   1681 - 1750
PEAKLAGFLRYISMQNLAVIFDLLLDSYRTAREFDTSPGLKCLLKKVSGIGGAANLYRQSAMSFNIYFHA   1751 - 1820
LVCAVLTNQETITAEQVKKVLFEDDERSTDSSQQCSSEDEDIFEETAQVSPPRGKEKRQWRARMPLLSVQ   1821 - 1890
PVSNADWVWLVKRLHKLCMELCNNYIQMHLDLENCMEEPPIFKGDPFFILPSFQSESSTPSTGGFSGKET   1891 - 1960
PSEDDRSQSREHMGESLSLKAGGGDLLLPPSPKVEKKDPSRKKEWWENAGNKIYTMAADKTISKLMTEYK   1961 - 2030
KRKQQHNLSAFPKEVKVEKKGEPLGPRGQDSPLLQRPQHLMDQGQMRHSFSAGPELLRQDKRPRSGSTGS   2031 - 2100
SLSVSVRDAEAQIQAWTNMVLTVLNQIQILPDQTFTALQPAVFPCISQLTCHVTDIRVRQAVREWLGRVG   2101 - 2170
RVYDIIV                                                                  2171 - 2177
//

Text Mined References (15)

PMID Year Title