Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.56
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.53797630496912E-60
lung carcinoma 2844 2.18247040382576E-20
astrocytoma 1493 1.40987785050242E-13
atypical teratoid / rhabdoid tumor 4369 1.71442005738574E-11
posterior fossa group B ependymoma 1530 1.05447952636665E-10
non-small cell lung cancer 2798 3.55726174255599E-9
oligodendroglioma 2849 1.47098430482749E-7
pediatric high grade glioma 2712 9.48426213437433E-7
interstitial cystitis 2299 1.19112539939022E-6
medulloblastoma, large-cell 6234 1.42197404656464E-6
ovarian cancer 8492 1.89119803447342E-6
glioblastoma 5572 1.1316771151444E-5
group 3 medulloblastoma 2254 6.38558379017069E-5
lung adenocarcinoma 2714 8.12635575513878E-5
primitive neuroectodermal tumor 3031 1.52640410463087E-4
pilocytic astrocytoma 3086 1.60064074164657E-4
ductal carcinoma in situ 1745 7.89509261674173E-4
cystic fibrosis 1670 9.12371415378613E-4
invasive ductal carcinoma 2950 0.00230930619080091
active Crohn's disease 918 0.00254515675286151
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00920307876336041
Pick disease 1893 0.0106383563462423
spina bifida 1064 0.0412572915265152
subependymal giant cell astrocytoma 2287 0.0434612411352385

Expression

  Differential Expression (24)

Synonym

Accession Q5TH69 C5NM88 Q76MU8 Q8N4Y4 Q96CH9 Q96P46 Q9ULH6
Symbols BIG3
A7322
C6orf92
PPP1R33
KIAA1244
dJ171N11.1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Zebrafish OMA EggNOG
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
24997568 BIG3 (ARFGEF3) is predicted to interact with its partner PHB2 through an ARM-type alpha-helical structure.

AA Sequence

MEEILRKLQKEASGSKYKAIKESCTWALETLGGLDTIVKIPPHVLREKCLLPLQLALESKNVKLAQHALA      1 - 70
GMQKLLSEERFVSMETDSDEKQLLNQILNAVKVTPSLNEDLQVEVMKVLLCITYTPTFDLNGSAVLKIAE     71 - 140
VCIETYISSCHQRSINTAVRATLSQMLSDLTLQLRQRQENTIIENPDVPQDFGNQGSTVESLCDDVVSVL    141 - 210
TVLCEKLQAAINDSQQLQLLYLECILSVLSSSSSSMHLHRRFTDLIWKNLCPALIVILGNPIHDKTITSA    211 - 280
HTSSTSTSLESDSASPGVSDHGRGSGCSCTAPALSGPVARTIYYIAAELVRLVGSVDSMKPVLQSLYHRV    281 - 350
LLYPPPQHRVEAIKIMKEILGSPQRLCDLAGPSSTESESRKRSISKRKSHLDLLKLIMDGMTEACIKGGI    351 - 420
EACYAAVSCVCTLLGALDELSQGKGLSEGQVQLLLLRLEELKDGAEWSRDSMEINEADFRWQRRVLSSEH    421 - 490
TPWESGNERSLDISISVTTDTGQTTLEGELGQTTPEDHSGNHKNSLKSPAIPEGKETLSKVLETEAVDQP    491 - 560
DVVQRSHTVPYPDITNFLSVDCRTRSYGSRYSESNFSVDDQDLSRTEFDSCDQYSMAAEKDSGRSDVSDI    561 - 630
GSDNCSLADEEQTPRDCLGHRSLRTAALSLKLLKNQEADQHSARLFIQSLEGLLPRLLSLSNVEEVDTAL    631 - 700
QNFASTFCSGMMHSPGFDGNSSLSFQMLMNADSLYTAAHCALLLNLKLSHGDYYRKRPTLAPGVMKDFMK    701 - 770
QVQTSGVLMVFSQAWIEELYHQVLDRNMLGEAGYWGSPEDNSLPLITMLTDIDGLESSAIGGQLMASAAT    771 - 840
ESPFAQSRRIDDSTVAGVAFARYILVGCWKNLIDTLSTPLTGRMAGSSKGLAFILGAEGIKEQNQKERDA    841 - 910
ICMSLDGLRKAARLSCALGVAANCASALAQMAAASCVQEEKEEREAQEPSDAITQVKLKVEQKLEQIGKV    911 - 980
QGVWLHTAHVLCMEAILSVGLEMGSHNPDCWPHVFRVCEYVGTLEHNHFSDGASQPPLTISQPQKATGSA    981 - 1050
GLLGDPECEGSPPEHSPEQGRSLSTAPVVQPLSIQDLVREGSRGRASDFRGGSLMSGSSAAKVVLTLSTQ   1051 - 1120
ADRLFEDATDKLNLMALGGFLYQLKKASQSQLFHSVTDTVDYSLAMPGEVKSTQDRKSALHLFRLGNAML   1121 - 1190
RIVRSKARPLLHVMRCWSLVAPHLVEAACHKERHVSQKAVSFIHDILTEVLTDWNEPPHFHFNEALFRPF   1191 - 1260
ERIMQLELCDEDVQDQVVTSIGELVEVCSTQIQSGWRPLFSALETVHGGNKSEMKEYLVGDYSMGKGQAP   1261 - 1330
VFDVFEAFLNTDNIQVFANAATSYIMCLMKFVKGLGEVDCKEIGDCAPAPGAPSTDLCLPALDYLRRCSQ   1331 - 1400
LLAKIYKMPLKPIFLSGRLAGLPRRLQEQSASSEDGIESVLSDFDDDTGLIEVWIILLEQLTAAVSNCPR   1401 - 1470
QHQPPTLDLLFELLRDVTKTPGPGFGIYAVVHLLLPVMSVWLRRSHKDHSYWDMASANFKHAIGLSCELV   1471 - 1540
VEHIQSFLHSDIRYESMINTMLKDLFELLVACVAKPTETISRVGCSCIRYVLVTAGPVFTEEMWRLACCA   1541 - 1610
LQDAFSATLKPVKDLLGCFHSGTESFSGEGCQVRVAAPSSSPSAEAEYWRIRAMAQQVFMLDTQCSPKTP   1611 - 1680
NNFDHAQSCQLIIELPPDEKPNGHTKKSVSFREIVVSLLSHQVLLQNLYDILLEEFVKGPSPGEEKTIQV   1681 - 1750
PEAKLAGFLRYISMQNLAVIFDLLLDSYRTAREFDTSPGLKCLLKKVSGIGGAANLYRQSAMSFNIYFHA   1751 - 1820
LVCAVLTNQETITAEQVKKVLFEDDERSTDSSQQCSSEDEDIFEETAQVSPPRGKEKRQWRARMPLLSVQ   1821 - 1890
PVSNADWVWLVKRLHKLCMELCNNYIQMHLDLENCMEEPPIFKGDPFFILPSFQSESSTPSTGGFSGKET   1891 - 1960
PSEDDRSQSREHMGESLSLKAGGGDLLLPPSPKVEKKDPSRKKEWWENAGNKIYTMAADKTISKLMTEYK   1961 - 2030
KRKQQHNLSAFPKEVKVEKKGEPLGPRGQDSPLLQRPQHLMDQGQMRHSFSAGPELLRQDKRPRSGSTGS   2031 - 2100
SLSVSVRDAEAQIQAWTNMVLTVLNQIQILPDQTFTALQPAVFPCISQLTCHVTDIRVRQAVREWLGRVG   2101 - 2170
RVYDIIV                                                                  2171 - 2177
//

Text Mined References (15)

PMID Year Title
24997568 2014 Brefeldin A-inhibited guanine nucleotide-exchange protein 3 (BIG3) is predicted to interact with its partner through an ARM-type ?-helical structure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19496786 2009 Activation of an estrogen/estrogen receptor signaling by BIG3 through its inhibitory effect on nuclear transport of PHB2/REA in breast cancer.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...