Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2716 6.1e-09
non-small cell lung carcinoma 317 6.0e-08
lung carcinoma 2843 4.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count
Bladder exstrophy 32

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.500 6.1e-09
lung carcinoma -1.500 4.5e-04
non-small cell lung carcinoma -1.100 6.0e-08

AA Sequence

MLTRNPKTKSSLQILQDSVKWHHMAHKVNSLLDAYSGLLSNESMILAVNSSFVDPLLQFESQLKIIESSF      1 - 70
GMLVVMPSLDKVKEMGSSYEYIEDMENLYHNILNIYENILTSLVSKDLYKLQILKEMLVWMSKDSSYLQE     71 - 140
RIMVIINKVLRFTVTKVRKYISVDAPCLGLLAAELSLLCSHEDPSIVKQASLGMCHLLYIARCQNDIGTN    141 - 210
KPTNGKSHSLQFPSSDVEFLPKEFQQDESKIAQRVGQTLLPPLLTDFVQSLLMKLSSPDDKIASDAASIL    211 - 280
IFTLEFHAEKVTMVSKIVDAIYRQLCDNNCMKDVMLQVITLLTCTSPKKVIFQLMDYPVPADDTLIQMWK    281 - 350
AACSQASVAPHVLKTILLILKGKPGEMEDTVTEGKRFSLDITNLMPLAACQALCTFLPLGSYRKAVAQYF    351 - 420
PQLLTTLMFQVFYNSELKPILKDRALYAQDALRVLLNCSGLQQVDITLMKENFWDQLSEDLCYYHGVCFI    421 - 490
AKTLSEYNFPQFPETLSYLYKLSVEGPRRSEDTVIVLIFLTEVSFVDCEQLCSHFLFLPKFKSKFQFLVS    491 - 560
LPLNVGSYQDLRS                                                             561 - 573
//

Text Mined References (5)

PMID Year Title