Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
oligodendroglioma 1.400 0.000
astrocytoma 1.400 0.000
glioblastoma 1.700 0.000
non diabetic and post-ischemic heart fai... -1.500 0.003
medulloblastoma, large-cell -1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.719 0.001
non-small cell lung cancer -1.076 0.000
colon cancer -1.100 0.032
lung cancer -2.200 0.000
diabetes mellitus -1.200 0.014
lung adenocarcinoma -1.700 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.208 0.003
psoriasis -1.100 0.000
lung carcinoma -2.000 0.000
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.041
ulcerative colitis 1.600 0.000
pituitary cancer -1.200 0.001
dermatomyositis 1.400 0.003

Synonym

Accession Q5TGL8 A8K0N3 Q6PGP0 Q86XB7
Symbols C6orf145

Gene

 Compartment GO Term (0)

AA Sequence

MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDA      1 - 70
FPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERSPLDQVLKNDN     71 - 140
VHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNGRDQQLGVDPTEHLFENGSEFPSELEDGDDP    141 - 210
AAYVTNLSYYHLVPFETDIWD                                                     211 - 231
//

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.