Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 4.14063527616533E-27
lung carcinoma 2844 4.30915526507839E-20
non-small cell lung cancer 2798 2.31910974564752E-17
oligodendroglioma 2849 5.17958972309783E-15
lung adenocarcinoma 2714 8.82360006523257E-14
psoriasis 6685 5.29597306629916E-12
pilocytic astrocytoma 3086 1.16645877462463E-8
Breast cancer 3099 3.75204462174269E-8
ulcerative colitis 2087 2.16164094033711E-6
pediatric high grade glioma 2712 2.78143363478097E-5
lung cancer 4473 8.81972809253451E-5
glioblastoma 5572 2.16094295361094E-4
medulloblastoma, large-cell 6234 3.7017604808666E-4
pituitary cancer 1972 5.18204292533342E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 9.47331862961189E-4
dermatomyositis 967 0.00278715014155572
non diabetic and post-ischemic heart failure 200 0.00296265211232331
subependymal giant cell astrocytoma 2287 0.00340849124139126
diabetes mellitus 1663 0.0142319669679815
colon cancer 1475 0.0322443524678501
invasive ductal carcinoma 2950 0.0414549399913989

Expression

  Differential Expression (21)

Disease log2 FC p
oligodendroglioma 1.400 0.000
astrocytoma 1.400 0.000
glioblastoma 1.700 0.000
non diabetic and post-ischemic heart fai... -1.500 0.003
medulloblastoma, large-cell -1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.719 0.001
non-small cell lung cancer -1.076 0.000
colon cancer -1.100 0.032
lung cancer -2.200 0.000
diabetes mellitus -1.200 0.014
lung adenocarcinoma -1.700 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.208 0.003
psoriasis -1.100 0.000
lung carcinoma -2.000 0.000
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.041
ulcerative colitis 1.600 0.000
pituitary cancer -1.200 0.001
dermatomyositis 1.400 0.003

Synonym

Accession Q5TGL8 A8K0N3 Q6PGP0 Q86XB7
Symbols C6orf145

Gene

  Ortholog (13)

 Compartment GO Term (1)

AA Sequence

MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDA      1 - 70
FPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERSPLDQVLKNDN     71 - 140
VHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNGRDQQLGVDPTEHLFENGSEFPSELEDGDDP    141 - 210
AAYVTNLSYYHLVPFETDIWD                                                     211 - 231
//

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.