Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (1)

AA Sequence

MPSSTLTCKPFDLKQRSSRRGPKSTASASPRSCLKPSCGKQVCLLLSVRRSQSLAHPGRDSTRVLSYQQT      1 - 70
SSDAVSQYKHTGKVEELYGLRLSWLSQAQFLLAQDKTAYAVKSVVLPASNHKTKGQ                   71 - 126
//

Text Mined References (2)

PMID Year Title