Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5TG92
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MPSSTLTCKPFDLKQRSSRRGPKSTASASPRSCLKPSCGKQVCLLLSVRRSQSLAHPGRDSTRVLSYQQT      1 - 70
SSDAVSQYKHTGKVEELYGLRLSWLSQAQFLLAQDKTAYAVKSVVLPASNHKTKGQ                   71 - 126
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).