Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.81
PubTator Score 14.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 4.64920726323294E-22
non-small cell lung cancer 2798 1.84222938610532E-16
lung adenocarcinoma 2714 4.34615488932869E-11
ovarian cancer 8492 4.35875333267512E-10
osteosarcoma 7933 3.81183039844824E-6
nasopharyngeal carcinoma 1056 8.49951896716186E-6
medulloblastoma, large-cell 6234 4.34566291445198E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.345 0.000
medulloblastoma, large-cell -1.200 0.000
non-small cell lung cancer -1.583 0.000
lung adenocarcinoma -1.100 0.000
nasopharyngeal carcinoma -1.200 0.000
lung carcinoma -1.600 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q5TCQ9 Q5TCQ8 Q5TCR0 Q9H2V6 Q9H5Y8 Q9HBC4 Q9HCD8
Symbols MAGI-3
dJ730K3.2

Gene

PDB

3SOE  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (8)

PMID Text
26452219 Results identify MAGI3 as a novel tumor suppressor and provide insight into the pathogenesis of glioma.
26248734 Expression levels of MAGI3 and PTEN were significantly downregulated in gliomas.
21134377 MAGI-3 competes with NHERF-2 to negatively regulate LPA2 receptor signaling in colon cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18518978 All of the E6 genes from different HPV types displayed similar abilities to mediate the degradation of both p53 and MAGI-3
16904289 These results demonstrate that MAGI-3 interacts directly with LPA(2) and regulates the ability of LPA(2) to activate Erk and RhoA.
12615970 In epithelial cells, MAGI-3 was localized with ZO-1 and cingulin at tight junctions, whereas in primary cultured astrocytes it was found in E-cadherin-based cell-cell contacts and in focal adhesion sites.
12140759 Oncogenic human papillomavirus E6 proteins target the MAGI-2 and MAGI-3 proteins for degradation [MAGI-2, MAGI-3]

AA Sequence

MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDV      1 - 70
LLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYL     71 - 140
RTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLF    141 - 210
DNEFDAESQRKRTTSVSKMERMDSSLPEEEEDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSM    211 - 280
DFRNYMMRDETLEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIED    281 - 350
PQYGTYYVDFTLVAQAGVQWHDLGSLQPPPPGFNHLNQKTQFENPVEEAKRKKQLGQVEIGSSKPDMEKS    351 - 420
HFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCV    421 - 490
LGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGA    491 - 560
MVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMIL    561 - 630
DSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAG    631 - 700
SLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDG    701 - 770
PDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEK    771 - 840
QPEDDSSQAFISTQNGSPRLNRAEVPARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRV    841 - 910
IEGSPADRCGKLKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPA    911 - 980
LQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELE    981 - 1050
RGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKV   1051 - 1120
LLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPLPPSSHFASIFEESHVPVIEESLRVQICEKAEELKD   1121 - 1190
IVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSHGHSNKKNLLKVENGVTRRGRSVSPKKPASQHSEEH   1191 - 1260
LDKIPSPLKNNPKRRPRDQSLSPSKGENKSCQVSTRAGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAE   1261 - 1330
AKLLEGKSRRIAGYTGSNAEQIPDGKEKSDVIRKDAKQNQLEKSRTRSPEKKIKRMVEKSLPSKMTNKTT   1331 - 1400
SKEVSENEKGKKVTTGETSSSNDKIGENVQLSEKRLKQEPEEKVVSNKTEDHKGKELEAADKNKETGRFK   1401 - 1470
PESSSPVKKTLITPGPWKVPSGNKVTGTIGMAEKRQ                                     1471 - 1506
//

Text Mined References (31)

PMID Year Title
26452219 2015 MAGI3 negatively regulates Wnt/?-catenin signaling and suppresses malignant phenotypes of glioma cells.
26248734 2015 MAGI3 Suppresses Glioma Cell Proliferation via Upregulation of PTEN Expression.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
23568457 2013 Genetic variants associated with disordered eating.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21134377 2011 MAGI-3 competes with NHERF-2 to negatively regulate LPA2 receptor signaling in colon cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20353789 2010 Beta-2 adrenergic receptor mediated ERK activation is regulated by interaction with MAGI-3.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...