Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 0.000

Gene RIF (2)

PMID Text
19601998 Observational study of gene-disease association. (HuGE Navigator)
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSSGGCCSSEGGGCCLS      1 - 70
HHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGGCC                           71 - 118
//

Text Mined References (5)

PMID Year Title
19896111 2009 Common variants in the trichohyalin gene are associated with straight hair in Europeans.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.