Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.0e-64
Disease Target Count Z-score Confidence
Irritant dermatitis 9 4.131 2.1
Tooth agenesis 44 3.556 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 2.0e-64

Gene RIF (2)

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSSGGCCSSEGGGCCLS      1 - 70
HHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGGCC                           71 - 118
//

Text Mined References (5)

PMID Year Title