Property Summary

Ligand Count 77
NCBI Gene PubMed Count 4
PubMed Score 0.84
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.990 2.4e-04
atypical teratoid / rhabdoid tumor -2.500 8.4e-05
Breast cancer 2.500 2.7e-02
breast carcinoma -1.400 6.3e-23
cystic fibrosis 2.201 1.2e-06
ependymoma 1.500 1.0e-02
glioblastoma -1.500 3.7e-04
group 3 medulloblastoma -1.700 3.6e-04
interstitial cystitis 1.100 2.3e-04
invasive ductal carcinoma -1.500 3.6e-03
lung cancer -1.200 1.5e-02
lung carcinoma -2.200 1.4e-30
malignant mesothelioma 1.500 2.2e-06
medulloblastoma, large-cell -3.100 6.1e-06
non primary Sjogren syndrome sicca 1.100 3.3e-02
osteosarcoma 1.348 1.9e-02
ovarian cancer -3.100 1.6e-07
pediatric high grade glioma -1.600 7.6e-05
primitive neuroectodermal tumor -1.700 2.0e-03
subependymal giant cell astrocytoma 1.095 4.7e-02
ulcerative colitis 1.600 1.7e-04

Synonym

Accession Q5TC84 Q2TAC1 Q8NEQ4 Q9H7B5
Symbols dJ331H24.1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MGNLLGGVSFREPTTVEDCDSTWQTDSEPEPEEPGPGGGSEGPGQESEQPAQPPEQAGGRPGASPAPDED      1 - 70
AEAAGAEQGGDSTEATAKPKRSFYAARDLYKYRHQYPNFKDIRYQNDLSNLRFYKNKIPFKPDGVYIEEV     71 - 140
LSKWKGDYEKLEHNHTYIQWLFPLREQGLNFYAKELTTYEIEEFKKTKEAIRRFLLAYKMMLEFFGIKLT    141 - 210
DKTGNVARAVNWQERFQHLNESQHNYLRITRILKSLGELGYESFKSPLVKFILHEALVENTIPNIKQSAL    211 - 280
EYFVYTIRDRRERRKLLRFAQKHYTPSENFIWGPPRKEQSEGSKAQKMSSPLASSHNSQTSMHKKAKDSK    281 - 350
NSSSAVHLNSKTAEDKKVAPKEPVEETDRPSPEPSNEAAKPRNTEKDSNAENMNSQPEKTVTTPTEKKES    351 - 420
VSPENNEEGGNDNQDNENPGNTNCHDVVLVQ                                           421 - 451
//

Text Mined References (6)

PMID Year Title