Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.23
PubTator Score 9.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 6.48280031421432E-49
breast carcinoma 1614 1.34276407193778E-31
non-small cell lung cancer 2798 1.28937116600526E-28
Breast cancer 3099 8.94904345208164E-15
atypical teratoid / rhabdoid tumor 4369 4.8729398817586E-10
sonic hedgehog group medulloblastoma 1482 3.83701168157384E-9
medulloblastoma, large-cell 6234 2.84678559921226E-7
lung adenocarcinoma 2714 1.5311760504926E-6
posterior fossa group A ependymoma 1511 2.29216524551784E-6
lung cancer 4473 5.58948656047863E-6
pediatric high grade glioma 2712 6.99758507507352E-6
ovarian cancer 8492 9.00952279264111E-6
malignant mesothelioma 3163 4.70322264374355E-5
glioblastoma 5572 9.13345541503989E-5
invasive ductal carcinoma 2950 1.0436961450932E-4
primitive neuroectodermal tumor 3031 1.23506263917464E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.83984051896943E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.40779721566251E-4
Atopic dermatitis 944 2.48992863072351E-4
primary Sjogren syndrome 789 0.00125103927782208
adrenocortical carcinoma 1427 0.00316032375024273
nasopharyngeal carcinoma 1056 0.00402078139537632
ductal carcinoma in situ 1745 0.00861026728454237

Expression

Synonym

Accession Q5TB30 A8QXE0 A8QXE1 Q05DU3 Q5TB28 Q9H9I3 Q9NX21 Q9NXZ0
Symbols DEP.8
SDP35
DEPDC1A
DEPDC1-V2

Gene

PANTHER Protein Class (1)

PDB

2YSR  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (7)

PMID Text
26970279 Results suggest that protocadherin 10 (PCDH10)-Dishevelled, EGL-10 and Pleckstrin domain containing 1 (DEPDC1)-caspase signaling may be a novel regulatory axis in endometrial endometrioid carcinoma (EEC) development.
25902835 DEPDC1, plays a pivotal role in the regulation of proper mitotic progression.
25605201 High DEPDC1 mRNA expression is associated with hepatocellular carcinoma/
25064737 DEPDC1 regulates vincristine-induced cell death by promoting JNK-dependent degradation of the BCL-2 family protein MCL1.
23646139 Inhibition of DEPDC1A, a bad prognostic marker in multiple myeloma, delays growth and induces mature plasma cell markers in malignant plasma cells.
20587513 Coimmunoprecipitation and immunocytochemistry revealed that DEPDC1 interacted and colocalized with zinc finger transcription factor ZNF224, a known transcriptional repressor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESQGVPPGPYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQ      1 - 70
QTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKL     71 - 140
RNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDVEEVWRYVILIYLQTILGVPSLEEV    141 - 210
INPKQVIPQYIMYNMANTSKRGVVILQNKSDDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIA    211 - 280
DYFLDLPEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNLNSFKSTECLLLSLL    281 - 350
HREKNKEESDSTERLQISNPGFQERCAKKMQLVNLRNRRVSANDIMGGSCHNLIGLSNMHDLSSNSKPRC    351 - 420
CSLEGIVDVPGNSSKEASSVFHQSFPNIEGQNNKLFLESKPKQEFLLNLHSEENIQKPFSAGFKRTSTLT    421 - 490
VQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNVGQGSTSVQTAMESELGESSATI    491 - 560
NKRLCKSTIELSENSLLPASSMLTGTQSLLQPHLERVAIDALQLCCLLLPPPNRRKLQLLMRMISRMSQN    561 - 630
VDMPKLHDAMGTRSLMIHTFSRCVLCCAEEVDLDELLAGRLVSFLMDHHQEILQVPSYLQTAVEKHLDYL    631 - 700
KKGHIENPGDGLFAPLPTYSYCKQISAQEFDEQKVSTSQAAIAELLENIIKNRSLPLKEKRKKLKQFQKE    701 - 770
YPLIYQKRFPTTESEAALFGDKPTIKQPMLILRKPKFRSLR                                 771 - 811
//

Text Mined References (16)

PMID Year Title
26970279 2016 Protocadherin 10 inhibits cell proliferation and induces apoptosis via regulation of DEP domain containing 1 in endometrial endometrioid carcinoma.
25902835 2015 DEPDC1 is a novel cell cycle related gene that regulates mitotic progression.
25605201 2014 DEP domain containing 1 is a novel diagnostic marker and prognostic predictor for hepatocellular carcinoma.
25064737 2014 DEPDC1/LET-99 participates in an evolutionarily conserved pathway for anti-tubulin drug-induced apoptosis.
23646139 2013 Inhibition of DEPDC1A, a bad prognostic marker in multiple myeloma, delays growth and induces mature plasma cell markers in malignant plasma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20587513 2010 Cell-permeable peptide DEPDC1-ZNF224 interferes with transcriptional repression and oncogenicity in bladder cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17452976 2007 Involvement of upregulation of DEPDC1 (DEP domain containing 1) in bladder carcinogenesis.
More...