Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 6
Funding $568,512.03
PubMed Score 12.23
PubTator Score 9.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26970279 Results suggest that protocadherin 10 (PCDH10)-Dishevelled, EGL-10 and Pleckstrin domain containing 1 (DEPDC1)-caspase signaling may be a novel regulatory axis in endometrial endometrioid carcinoma (EEC) development.
25902835 DEPDC1, plays a pivotal role in the regulation of proper mitotic progression.
25605201 High DEPDC1 mRNA expression is associated with hepatocellular carcinoma/
25064737 DEPDC1 regulates vincristine-induced cell death by promoting JNK-dependent degradation of the BCL-2 family protein MCL1.
23646139 Inhibition of DEPDC1A, a bad prognostic marker in multiple myeloma, delays growth and induces mature plasma cell markers in malignant plasma cells.
20587513 Coimmunoprecipitation and immunocytochemistry revealed that DEPDC1 interacted and colocalized with zinc finger transcription factor ZNF224, a known transcriptional repressor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESQGVPPGPYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQ      1 - 70
QTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKL     71 - 140
RNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDVEEVWRYVILIYLQTILGVPSLEEV    141 - 210
INPKQVIPQYIMYNMANTSKRGVVILQNKSDDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIA    211 - 280
DYFLDLPEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNLNSFKSTECLLLSLL    281 - 350
HREKNKEESDSTERLQISNPGFQERCAKKMQLVNLRNRRVSANDIMGGSCHNLIGLSNMHDLSSNSKPRC    351 - 420
CSLEGIVDVPGNSSKEASSVFHQSFPNIEGQNNKLFLESKPKQEFLLNLHSEENIQKPFSAGFKRTSTLT    421 - 490
VQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNVGQGSTSVQTAMESELGESSATI    491 - 560
NKRLCKSTIELSENSLLPASSMLTGTQSLLQPHLERVAIDALQLCCLLLPPPNRRKLQLLMRMISRMSQN    561 - 630
VDMPKLHDAMGTRSLMIHTFSRCVLCCAEEVDLDELLAGRLVSFLMDHHQEILQVPSYLQTAVEKHLDYL    631 - 700
KKGHIENPGDGLFAPLPTYSYCKQISAQEFDEQKVSTSQAAIAELLENIIKNRSLPLKEKRKKLKQFQKE    701 - 770
YPLIYQKRFPTTESEAALFGDKPTIKQPMLILRKPKFRSLR                                 771 - 811
//

Text Mined References (16)

PMID Year Title
26970279 2016 Protocadherin 10 inhibits cell proliferation and induces apoptosis via regulation of DEP domain containing 1 in endometrial endometrioid carcinoma.
25902835 2015 DEPDC1 is a novel cell cycle related gene that regulates mitotic progression.
25605201 2014 DEP domain containing 1 is a novel diagnostic marker and prognostic predictor for hepatocellular carcinoma.
25064737 2014 DEPDC1/LET-99 participates in an evolutionarily conserved pathway for anti-tubulin drug-induced apoptosis.
23646139 2013 Inhibition of DEPDC1A, a bad prognostic marker in multiple myeloma, delays growth and induces mature plasma cell markers in malignant plasma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20587513 2010 Cell-permeable peptide DEPDC1-ZNF224 interferes with transcriptional repression and oncogenicity in bladder cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17452976 2007 Involvement of upregulation of DEPDC1 (DEP domain containing 1) in bladder carcinogenesis.
More...