Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
R01 Count 9
Funding $2,373,542.67
PubMed Score 11.68
PubTator Score 12.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.400 0.006
ependymoma 1.800 0.003
osteosarcoma 1.389 0.001
group 4 medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.009
primitive neuroectodermal tumor 1.300 0.004
intraductal papillary-mucinous neoplasm ... -1.100 0.026
lung cancer 1.200 0.041
Breast cancer -1.100 0.001

Gene RIF (13)

PMID Text
26114892 Data indicate that some of the small molecules were validated as specific inhibitors of 3' terminal uridylyl transferase (TUTase) Zcchc11 (TUT4) activity.
25480299 Study identified TUT4 and TUT7 as uridylyl transferases for poly(A)+ mRNAs in humans and delineated in detail the action mechanism and molecular function of uridylation in the mRNA decay pathway.
24056962 miR-26a directly targets Lin28B and Zcchc11-two critical repressors of let-7 maturation.
23063654 Study identified TUT7, TUT4, and TUT2 as novel components of the miRNA biogenesis pathway.
22898984 Lin28 uses two different TUTases to control let-7 expression .
22006926 Terminal uridyltransferase enzyme Zcchc11 promotes cell proliferation independent of its uridyltransferase activity
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19703396 This study uncovers the role of TUT4 and Lin28 as specific suppressors of microRNA biogenesis, which has implications for stem cell research and cancer biology.
More...

AA Sequence

MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEV      1 - 70
KSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAKAEKSPKSPNSVKA     71 - 140
EKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSP    141 - 210
RSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQA    211 - 280
EERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPA    281 - 350
HLAALSVAVIELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFP    351 - 420
PKMNHPDLLIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIE    421 - 490
PVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLK    491 - 560
GIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKKTETDNQSNAMKEKHGKSPLALETPNRVSLG    561 - 630
QLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEYVVERF    631 - 700
RAAYRYFACPQTKGGNKSTVDFKKREKGKISNKKPVKSNNMATNGCILLGETTEKINAEREQPVQCDEMD    701 - 770
CTSQRCIIDNNNLLVNELDFADHGQDSSSLSTSKSSEIEPKLDKKQDDLAPSETCLKKELSQCNCIDLSK    771 - 840
SPDPDKSTGTDCRSNLETESSHQSVCTDTSATSCNCKATEDASDLNDDDNLPTQELYYVFDKFILTSGKP    841 - 910
PTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPMTNRFREILDLVCKRCFDELSPPCSEQHNREQILIGLE    911 - 980
KFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPI    981 - 1050
TTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLS   1051 - 1120
SYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWL   1121 - 1190
GLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAFINGRK   1191 - 1260
LFGTPFYPLIGREAEYFFDSRVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKSLLFRLKKKDSEEEKEGN   1261 - 1330
EEEKDSRDVLDPRDLHDTRDFRDPRDLRCFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRNLVNAQQV   1331 - 1400
AGSAQQQGDQSIRTRQSSECSESPSYSPQPQPFPQNSSQSAAITQPSSQPGSQPKLGPPQQGAQPPHQVQ   1401 - 1470
MPLYNFPQSPPAQYSPMHNMGLLPMHPLQIPAPSWPIHGPVIHSAPGSAPSNIGLNDPSIIFAQPAARPV   1471 - 1540
AIPNTSHDGHWPRTVAPNSLVNSGAVGNSEPGFRGLTPPIPWEHAPRPHFPLVPASWPYGLHQNFMHQGN   1541 - 1610
ARFQPNKPFYTQDRCATRRCRERCPHPPRGNVSE                                       1611 - 1644
//

Text Mined References (29)

PMID Year Title
26114892 2015 Identification of small molecule inhibitors of Zcchc11 TUTase activity.
25480299 2014 Uridylation by TUT4 and TUT7 marks mRNA for degradation.
24056962 2014 miR-26a enhances miRNA biogenesis by targeting Lin28B and Zcchc11 to suppress tumor growth and metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063654 2012 Mono-uridylation of pre-microRNA as a key step in the biogenesis of group II let-7 microRNAs.
22898984 2012 Lin28-mediated control of let-7 microRNA expression by alternative TUTases Zcchc11 (TUT4) and Zcchc6 (TUT7).
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22118463 2011 Lin28A and Lin28B inhibit let-7 microRNA biogenesis by distinct mechanisms.
More...