Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Breast cancer -1.300 9.3e-03
esophageal adenocarcinoma -1.600 2.3e-02
gastric cancer 1.500 3.1e-04
hepatocellular carcinoma 1.100 7.1e-05
interstitial cystitis -1.500 3.4e-03
intraductal papillary-mucinous adenoma (... 1.100 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.800 5.0e-04
medulloblastoma, large-cell 1.400 2.7e-05
nasopharyngeal carcinoma -1.700 1.6e-05
non primary Sjogren syndrome sicca 1.200 1.5e-02
non-small cell lung cancer 1.552 4.4e-11
osteosarcoma -3.911 4.5e-10
ovarian cancer 1.200 3.3e-09
pancreatic cancer 1.100 2.1e-04
pancreatic ductal adenocarcinoma liver m... 1.337 9.2e-03
pituitary cancer -1.200 2.1e-02
psoriasis 1.100 2.2e-26
spina bifida -2.342 4.2e-02

AA Sequence

MAELEAVADDLDALIDDLDYLPGHFHLEMQLNFEPRSPAPQRARDLKLQREGLRQELQLAAAPQRPAVRH      1 - 70
LLGAFAFYLEELDEARECFLEVAHEHPGNLNAWANLAHVYGRLGQEEEEEACAARLADLMGLAEEPEAAG     71 - 140
DPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEKRGWYFTMATLYIRLD    141 - 210
GIFLELGSEEQKRLPAFNRTLALLRQVLKSEDPRHRALAWCYLGMLLERKDTFSTTPMGVHDCGYSGTDP    211 - 280
LDCFGKAIEIAKNQPPILNRLAKIFYFLGKQDMAIGTCNMALDVLRDPELNWQAYCTRAKIHIRAYLHDL    281 - 350
KRAKMGLGGMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLA    351 - 420
KAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTDGFGCLLEALLAQWSQAQLSD    421 - 490
GELGREVDAWLRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGRPALVRLLFETMEREGEGASA    491 - 560
PRDRRAVSF                                                                 561 - 569
//

Text Mined References (3)

PMID Year Title