Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.43
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 5.27912388501975E-21
Breast cancer 3099 7.15421807982724E-8
adult high grade glioma 2148 3.16233976393396E-5
primary Sjogren syndrome 789 4.36788050055246E-4
atypical teratoid / rhabdoid tumor 4369 0.00112926870938621
astrocytic glioma 2241 0.0012463865601126
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00130999445343835
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00538388126742483
oligodendroglioma 2849 0.00639265477376484
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00823206216264899
primitive neuroectodermal tumor 3031 0.00921980088370143
medulloblastoma, large-cell 6234 0.0101184129217405
medulloblastoma 1524 0.0206352589175098
Disease Target Count Z-score Confidence
Klinefelter's syndrome 59 3.651 1.8

Expression

Synonym

Accession Q5T8I9 A8MRR6 B1AM16 B1AM17 Q96EJ7 Q96NN0
Symbols HEN1
C1orf59

Gene

PDB

4XCX  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC      1 - 70
IELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSG     71 - 140
DLARFPEVVFGYLSPSMIVISTPNSEFNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGV    141 - 210
GEPPAGAENVGYCTQIGIFRKNGGKATESCLSEQHDQHVYKAVFTTSYPSLQQERFFKLVLVNEVSQQVE    211 - 280
SLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIENSPTPFCVGDKFFVPLQRLLAYP    281 - 350
KLNRLCANEEMMRSVIADSIPLSSDGSAVVADLRNYFDEQFEF                               351 - 393
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.