Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.62
PubTator Score 6.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 5.01764124830228E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.80787306025485E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.31961909058718E-5
medulloblastoma, large-cell 6234 6.0100940575386E-5
primary pancreatic ductal adenocarcinoma 1271 0.00226212733251781
glioblastoma 5572 0.0047385082034216
oligodendroglioma 2849 0.0057905142165294
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0103124938256948
Disease Target Count Z-score Confidence
Fundus dystrophy 77 4.228 2.1

Expression

Gene

PANTHER Protein Class (1)

PDB

3FLV  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
Fruitfly EggNOG Inparanoid

 GO Process (2)

Gene RIF (5)

PMID Text
25175022 Findings suggest that the ACBD5-RET rearrangement is causatively involved in the development of papillary thyroid cancer.
24905344 Yeast Atg37, which is homologous to human ACBD5, is involved in autophagy of peroxisomes.
22190034 HIV-1 Vpr is identified to have a physical interaction with acyl-CoA binding domain containing 5 (ACBD5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20626622 A mutation in the acyl-coenzyme A binding domain-containing protein 5 gene (ACBD5 ) may have a role in autosomal dominant thrombocytopenia
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFQFHAGSWESWCCCCLIPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLK      1 - 70
FYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRV     71 - 140
IGPFYEIVEDKKSGRSSDITSVRLEKISKCLEDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVK    141 - 210
GAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSA    211 - 280
VCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGF    281 - 350
REDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEG    351 - 420
TKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQ    421 - 490
PTSQRPSWWPFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLN                              491 - 534
//

Text Mined References (23)

PMID Year Title
25175022 2014 A novel RET rearrangement (ACBD5/RET) by pericentric inversion, inv(10)(p12.1;q11.2), in papillary thyroid cancer from an atomic bomb survivor exposed to high-dose radiation.
24905344 2014 Atg37 regulates the assembly of the pexophagic receptor protein complex.
24535825 2014 Peroxisomal Atg37 binds Atg30 or palmitoyl-CoA to regulate phagophore formation during pexophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105016 2013 Autozygome-guided exome sequencing in retinal dystrophy patients reveals pathogenetic mutations and novel candidate disease genes.
20626622 2010 A mutation in the acyl-coenzyme A binding domain-containing protein 5 gene (ACBD5?) identified in autosomal dominant thrombocytopenia.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...