Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MWLDTRNLGIVISCWKGVCVPQTTTLEMFYNDNDRVEESSNSYQIRREFLLPACLPAFLSFSTSFSFFLS      1 - 70
FLPLSLSLFLPFFPSFFLSLSLSPSFLPSFLRQGLALSPRLECDGAIMIHCSLNIPGSSDPPTSAS         71 - 136
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.