Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T7N8 Q5VSL6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLEKRLLRMGMRLQLLRDRRISSRGPGLHRAKADPQQQKRLTTGLMTQAETQKEAQQRQAAMRKTALWHT      1 - 70
GHLQPKTHTHTGMHTQTHRERERNTQRLRDRERRENGRHTHRHTHTLTHTHTHRDTHTASYRRGIETHTT     71 - 140
RQPLRLRGSAHDENDPRVREQPRGTQADLSSRSRMAARLLGRLTPTNTVRAGLRLGSRAASPDPAWGFLI    141 - 210
VVGPL                                                                     211 - 215
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.