Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.61
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5T7M9 Q6IRV2
Symbols

Gene

Gene RIF (4)

PMID Text
20087403 An analysis and fine mapping of GFI-EVI5-RPL5-FAM69A locus, genotyping eight Tag-single nucleotide polymorphisms in 732 multiple sclerosis patients and 974 controls from Spain, was performed.
20087403 Observational study of gene-disease association. (HuGE Navigator)
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19506219 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARSLCPGAWLRKPYYLQARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKIICDKYKTG      1 - 70
VIDGPACNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKP     71 - 140
TRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADGDKDGQVSLGEAKSAWALLQLNEFLLMVILQ    141 - 210
DKEHTPKLMGFCGDLYVMESVEYTSLYGISLPWVIELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVE    211 - 280
DVFHGPYGNFLMCDTSAKNLGYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQS    281 - 350
TMKCTSEVIQPNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK    351 - 420
KISYTNDS                                                                  421 - 428
//

Text Mined References (14)

PMID Year Title
23840464 2013 A novel predicted calcium-regulated kinase family implicated in neurological disorders.
21334309 2011 Characterisation of the FAM69 family of cysteine-rich endoplasmic reticulum proteins.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20087403 2010 Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk locus for multiple sclerosis.
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
19525955 2009 Genome-wide association study identifies new multiple sclerosis susceptibility loci on chromosomes 12 and 20.
19506219 2009 Risk alleles for multiple sclerosis in multiplex families.
17660530 2007 Risk alleles for multiple sclerosis identified by a genomewide study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...