Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.61
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MARSLCPGAWLRKPYYLQARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKIICDKYKTG      1 - 70
VIDGPACNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKP     71 - 140
TRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADGDKDGQVSLGEAKSAWALLQLNEFLLMVILQ    141 - 210
DKEHTPKLMGFCGDLYVMESVEYTSLYGISLPWVIELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVE    211 - 280
DVFHGPYGNFLMCDTSAKNLGYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQS    281 - 350
TMKCTSEVIQPNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK    351 - 420
KISYTNDS                                                                  421 - 428
//

Text Mined References (14)

PMID Year Title