Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.62
PubTator Score 9.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
breast carcinoma 1638 2.7e-02

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.400 2.7e-02

Gene RIF (3)

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSS      1 - 70
GGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC                           71 - 118
//

Text Mined References (5)

PMID Year Title