Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.62
PubTator Score 9.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
breast carcinoma 1,614

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.400 0.027

Gene RIF (3)

PMID Text
20643763 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV

AA Sequence

MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSS      1 - 70
GGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC                           71 - 118
//

Text Mined References (5)

PMID Year Title
20643763 2010 Variants in linkage disequilibrium with the late cornified envelope gene cluster deletion are associated with susceptibility to psoriatic arthritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.