Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.48
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 9.1e-03
atypical teratoid / rhabdoid tumor -1.200 4.2e-03
Breast cancer -3.000 4.2e-02
breast carcinoma -1.200 1.3e-04
ductal carcinoma in situ -1.600 1.0e-03
ependymoma -1.500 2.5e-02
fibroadenoma -1.100 1.3e-02
intraductal papillary-mucinous adenoma (... -2.000 7.7e-06
intraductal papillary-mucinous carcinoma... -1.800 5.0e-06
intraductal papillary-mucinous neoplasm ... -1.900 2.3e-04
invasive ductal carcinoma -2.500 1.1e-04
lung adenocarcinoma -1.300 2.0e-16
medulloblastoma -1.100 2.1e-02
non-small cell lung cancer -2.594 2.0e-26
oligodendroglioma -1.500 8.9e-03
pituitary cancer -1.600 1.1e-05

Gene RIF (1)

AA Sequence

MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEIHRVPTQRRPS      1 - 70
QFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIACFAVIVSAKRAVERHESLTS     71 - 140
WNLAKKAKWREEAALAAQAKAK                                                    141 - 162
//

Text Mined References (6)

PMID Year Title