Property Summary

NCBI Gene PubMed Count 2
PubMed Score 16.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0

AA Sequence

MPAAFPCVFPPQSLQVFPQMIVKVWEKQSLPLPGLRGSPVERLYLPRNELDNPHKQKAWKIYPPEFAVEI      1 - 70
LFGMVSVDSLLFVLSSPHWWLHLAQGSFWMSEGGFSLCHPGWSVVAQSLLTSTSAFCVRAILLPQPPE       71 - 138
//

Text Mined References (3)

PMID Year Title