Property Summary

NCBI Gene PubMed Count 2
PubMed Score 16.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q5T6R2 B3KST4 B4DMH9
Symbols

Gene

AA Sequence

MPAAFPCVFPPQSLQVFPQMIVKVWEKQSLPLPGLRGSPVERLYLPRNELDNPHKQKAWKIYPPEFAVEI      1 - 70
LFGMVSVDSLLFVLSSPHWWLHLAQGSFWMSEGGFSLCHPGWSVVAQSLLTSTSAFCVRAILLPQPPE       71 - 138
//

Text Mined References (3)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.