Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.53

Knowledge Summary

Patent

No data available

Synonym

Accession Q5T699
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MDEIYKITSTERVQLLEKKLAVQLTELKSEIEEQGALQGTANRVYSSIQMPKDIYYFRRERELALKKTLQ      1 - 70
VAESKPLVVQADAVQRELESCLRREYTPENLPLLLLQYYTERIAQLAQSKYLHMLRWKRFCQHSKIMEQL     71 - 140
YPLYKKQVGYIMQEYNDTLQRAERLSVARENFLMGKNNPPNLVTQEDLTIYTKWLVCHLHSLGTVHQYLQ    141 - 210
ALQYLPISKVLSVAFNRVAEAGQKNENVCVNDIDPDIQGSASPDPVDTSISGPMRTEAAFVLPQHATETG    211 - 280
ELKPQLKLLLSHFSIPYDVEELWDSAKEMELFSLVSQKFQSVFMEQQRLQMFPDCEAGIAKADNLGLAGP    281 - 350
RMTLKKKANWISFIKIKPKCDPWQKKLLTKLKERRRTDALLQLQAKFLKISNPE                    351 - 404
//

Text Mined References (1)

PMID Year Title
14574404 2003 The DNA sequence and analysis of human chromosome 6.