Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.6e-04
nasopharyngeal carcinoma 1058 1.7e-04
chronic rhinosinusitis 512 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.804 1.7e-02
ependymoma 1.500 1.6e-04
nasopharyngeal carcinoma -1.200 1.7e-04

Synonym

Accession Q5T655 D3DRA6 Q8NA27
Symbols CCDC147
C10orf80
bA127L20.4
bA127L20.5
bA554P13.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAEEKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAE      1 - 70
IVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGL     71 - 140
SMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLAQTTEQQQETERSKEEAEHAISQFQQEIQQRQNE    141 - 210
ASREFRKKEKLEKELKQIQADMDSRQTEIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKELEQFQMR    211 - 280
NAKLQQENEQHSLVCEQLSQENQQKALELKAKEEEVHQMRLDIGKLNKIREQIHKKLHHTEDQKAEVEQH    281 - 350
KETLKNQIVGLEREVEASKKQAELDRKAMDELLRERDILNKNMLKAVNATQKQTDLVKLHEQAKRNLEGE    351 - 420
IQNYKDEAQKQRKIIFHLEKERDRYINQASDLTQKVLMNMEDIKVRETQIFDYRKKIAESEIKLKQQQNL    421 - 490
YEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAE    491 - 560
LQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEK    561 - 630
IKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRAL    631 - 700
EEELENPLNVHRWRKLEASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKHVLARQPG    701 - 770
PEAAEQLKLYRRTLHDKKQQLKVLSSELNMYEVQSKEYKYEVEKLTNELQNLKKKYLAQKRKEQLQKNKD    771 - 840
TAPMDNTFLMVKPNGPGFTGGGFPLRSTKMTF                                          841 - 872
//

Text Mined References (7)

PMID Year Title