Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.34
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 8.3e-03
colon cancer 1.200 2.7e-03
Gaucher disease type 1 1.200 8.8e-03
intraductal papillary-mucinous adenoma (... -1.200 9.8e-04
intraductal papillary-mucinous carcinoma... -1.100 5.0e-03
osteosarcoma -1.081 8.4e-04
ovarian cancer 1.200 7.0e-04
psoriasis -1.600 1.8e-04

Gene RIF (1)

AA Sequence

MALCALTRALRSLNLAPPTVAAPAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRT      1 - 70
KYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIA     71 - 140
LVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA    141 - 210
GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGRWHRKGG    211 - 280
WAGRKIRPLPPMKSYVKLPSASAQS                                                 281 - 305
//

Text Mined References (17)

PMID Year Title