Property Summary

NCBI Gene PubMed Count 8
Grant Count 11
R01 Count 11
Funding $665,163.84
PubMed Score 29.61
PubTator Score 7.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 GO Function (1)

Gene RIF (5)

PMID Text
26507581 Data shows that BEND3 associates with chromatin remodeling complexes to modulate gene expression and heterochromatin organization.
26481236 propose that there is a link between binding of BEND3 to the CALR rs138452745 C-allele and removal of NFI binding site from this nucleotide, and the evolution of human-specific higher brain functions
26100909 Data show that SUMOylated BANP, E5R, and Nac1 (BEN) domain 3 (BEND3) stabilizes NoRC component TTF-1-interacting protein 5 (Tip5)via association with ubiquitin specific protease 21 (USP21) debiquitinase.
25600804 Three basic amino acid residues located in the N-terminal region of BEND3 (BEND356-58, KRK) are essential for its nuclear localization, suggesting that these residues play a role as a functional nuclear localization signals.
21914818 associates with heterochromatin and represses transcription

AA Sequence

MNSTEFTEDVEEVLKSITVKVETEAEDAALDCSVNSRTSEKHSVDSVLTALQDSSKRKQLVSDGLLDSVP      1 - 70
GVKRRRLIPEALLAGMRNRENSSPCQGNGEQAGRGRSLGNVWPGEEEPCNDATTPSYKKPLYGISHKIME     71 - 140
KKNPPSGDLLNVYELFEKANASNSPSSLRLLNEPQKRDCGSTGAGTDNDPNIYFLIQKMFYMLNTLTSNM    141 - 210
SQLHSKVDLLSLEVSRIKKQVSPTEMVAKFQPPPEYQLTAAELKQIVDQSLSGGDLACRLLVQLFPELFS    211 - 280
DVDFSRGCSACGFAAKRKLESLHLQLIRNYVEVYYPSVKDTAVWQAECLPQLNDFFSRFWAQREMEDSQP    281 - 350
SGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFP    351 - 420
ELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPDMQEEEAWLQQCAQRINDELEGLGLDAGSE    421 - 490
GDPPRDDCYDSSSLPDDISVVKVEDSFEGERPGRRSKKIWLVPIDFDKLEIPQPDFEVPGADCLLSKEQL    491 - 560
RSIYESSLSIGNFASRLLVHLFPELFTHENLRKQYNCSGSLGKKQLDPSRIKLIRHYVQLLYPRAKNDRV    561 - 630
WTLEFVGKLDERCRRRDTEQRRSYQQQRKVHVPGPECRDLTSYAINPERFREEFEGPPLPPERSSKDFCK    631 - 700
IPLDELVVPSPDFPVPSPYLLSDKEVREIVQQSLSVGNFAARLLVRLFPELFTAENLRLQYNHSGACNKK    701 - 770
QLDPTRLRLIRHYVEAVYPVEKMEEVWHYECIPSIDERCRRPNRKKCDILKKAKKVEK                771 - 828
//

Text Mined References (19)

PMID Year Title
26507581 2015 BEND3 mediates transcriptional repression and heterochromatin organization.
26481236 2016 BEND3 is involved in the human-specific repression of calreticulin: Implication for the evolution of higher brain functions in human.
26100909 2015 BEND3 represses rDNA transcription by stabilizing a NoRC component via USP21 deubiquitinase.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25600804 2015 Basic amino acid residues located in the N-terminal region of BEND3 are essential for its nuclear localization.
25416956 2014 A proteome-scale map of the human interactome network.
25400923 2014 Human T cells expressing BEND3 on their surface represent a novel subpopulation that preferentially produces IL-6 and IL-8.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
More...