Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.94
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.293 5.8e-05
aldosterone-producing adenoma -1.348 1.2e-02
gastric cancer 1.700 1.8e-03
hepatocellular carcinoma 1.900 4.4e-06
intraductal papillary-mucinous neoplasm ... 2.100 3.8e-04
lung adenocarcinoma 1.106 1.4e-05
osteosarcoma 2.304 3.8e-04
ovarian cancer 1.200 1.9e-02
pancreatic cancer 1.200 2.3e-02
pancreatic carcinoma 1.200 2.3e-02
spina bifida -2.155 3.0e-02
tuberculosis -1.500 1.3e-03

Gene RIF (3)

AA Sequence

MSNNLRRVFLKPAEENSGNASRCVSGCMYQVVQTIGSDGKNLLQLLPIPKSSGNLIPLVQSSVMSDALKG      1 - 70
NTGKPVQVTFQTQISSSSTSASVQLPIFQPASSSNYFLTRTVDTSEKGRVTSVGTGNFSSSVSKVQSHGV     71 - 140
KIDGLTMQTFAVPPSTQKDSSFIVVNTQSLPVTVKSPVLPSGHHLQIPAHAEVKSVPASSLPPSVQQKIL    141 - 210
ATATTSTSGMVEASQMPTVIYVSPVNTVKNVVTKNFQNIYPKPVTEIAKPVILNTTQIPKNVATETQLKG    211 - 280
GQHSQAAPVKWIFQDNLQPFTPSLVPVKSSNNVASKILKTFVDRKNLGDNTINMPPLSTIDPSGTRSKNM    281 - 350
PIKDNALVMFNGKVYLLAKKGTDVLPSQIDQQNSVSPDTPVRKDTLQTVSSSPVTEISREVVNIVLAKSK    351 - 420
SSQMETKSLSNTQLASMANLRAEKNKVEKPSPSTTNPHMNQSSNYLKQSKTLFTNPIFPVGFSTGHNAPR    421 - 490
KVTAVIYARKGSVLQSIEKISSSVDATTVTSQQCVFRDQEPKIHNEMASTSDKGAQGRNDKKDSQGRSNK    491 - 560
ALHLKSDAEFKKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGERKQQNFDKKR    561 - 630
KAKTNKKMDHIKKRKTENAYNAIINGEANVTGSQLLSSILPTSDVSQHNILTSHSKTRQEKRTEMEYYTH    631 - 700
EKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVTPPELEETIRDEKIRRLKQVLREKEAALEEMRKKMHQK     701 - 769
//

Text Mined References (25)

PMID Year Title