Property Summary

NCBI Gene PubMed Count 75
Grant Count 134
R01 Count 88
Funding $11,931,674.79
PubMed Score 63.20
PubTator Score 55.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.700 0.000

Synonym

Accession Q5T2W1 B4DPB9 E7EU02 O60450 Q5T5P6 Q9BQ41 NHERF-3
Symbols CAP70
CLAMP
PDZD1
NHERF3
NHERF-3

Gene

PDB

3TMH   2EEI   2EEJ   2VSP   4Q2P  

Gene RIF (44)

PMID Text
26183824 PARP regulates estradiol-mediated cell growth by controlling the ER/IGF-1R/PDZK1 axis.
25562428 PDZK1, negatively regulates 5-HT2AR endocytosis and has no effect upon 5-HT2AR-mediated ERK1/2 phosphorylation.
25526531 IRF3 activation by innate antiviral signaling represses TGF-beta-induced growth inhibition, gene regulation and epithelial-mesenchymal transition, and the generation of Treg effector lymphocytes from naive CD4(+) lymphocytes.
25362723 PDZKA1 adaptor protein gene of urate transporters, is not associated with gout.
25348485 Described is a structure of D-AKAP2 in complex with two interacting partners and the exact mechanism by which a segment that on its own is disordered presents an alpha-helix to PKA and a beta-strand to PDZK1.
25271043 Inflammation-induced loss of PDZK1 expression may contribute to the NHE3 dysfunction observed in the inflamed intestine.
24869908 Correlation between PDZK1, Cdc37, Akt and breast cancer malignancy: the role of PDZK1 in cell growth through Akt stabilization by increasing and interacting with Cdc37
24728453 PDZK1 and NHERF1 regulate the transport function of OATP1A2 by modulating protein internalization via a clathrin-dependent pathway and by enhancing protein stability.
24436471 NHERF3 is a key regulator of organic transport in the kidney, particularly MRP4-mediated clearance of drug molecules.
23821363 These results clarify the relationship between ER-alpha and PDZK1, propose a direct relationship between PDZK1 and IGF1R, and identify a novel oncogenic activity for PDZK1 in breast cancer.
More...

AA Sequence

MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRINGVFVDKEEHMQ      1 - 70
VVDLVRKSGNSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQTWTQPRLCYLVK     71 - 140
EGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFL    141 - 210
LVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEA    211 - 280
GLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVK    281 - 350
EAPAPTPTSLEVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDE    351 - 420
DVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDTPPDSKEGIVV    421 - 490
ESNHDSHMAKERAHSTASHSSSNSEDTEM                                             491 - 519
//

Text Mined References (76)

PMID Year Title
26183824 2015 Poly(ADP-ribose) polymerase as a novel regulator of 17?-estradiol-induced cell growth through a control of the estrogen receptor/IGF-1 receptor/PDZK1 axis.
25562428 2015 PDZK1/NHERF3 differentially regulates corticotropin-releasing factor receptor 1 and serotonin 2A receptor signaling and endocytosis.
25526531 2014 Innate antiviral host defense attenuates TGF-? function through IRF3-mediated suppression of Smad signaling.
25362723 2014 Common variant of PDZK1, adaptor protein gene of urate transporters, is not associated with gout.
25348485 2015 D-AKAP2:PKA RII:PDZK1 ternary complex structure: insights from the nucleation of a polyvalent scaffold.
25271043 2015 Evidence for a causal link between adaptor protein PDZK1 downregulation and Na?/H? exchanger NHE3 dysfunction in human and murine colitis.
24869908 2014 Correlation between PDZK1, Cdc37, Akt and breast cancer malignancy: the role of PDZK1 in cell growth through Akt stabilization by increasing and interacting with Cdc37.
24728453 2014 PDZK1 and NHERF1 regulate the function of human organic anion transporting polypeptide 1A2 (OATP1A2) by modulating its subcellular trafficking and stability.
24436471 2014 Na?/H? exchanger regulatory factor 3 is critical for multidrug resistance protein 4-mediated drug efflux in the kidney.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...