Property Summary

NCBI Gene PubMed Count 15
Grant Count 16
R01 Count 14
Funding $1,136,027.15
PubMed Score 32.77
PubTator Score 26.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.200 0.001

Gene RIF (10)

PMID Text
24614704 With a sensitivity of 100% and a specificity of 97% in the detection of central nervous system (CNS) germinomas, UTF1 serves as a new reliable alternative in the diagnostic setting of CNS germ cell tumours.
23536577 UTF1 attenuates cell proliferation and is inactivated in cervical carcinogenesis through epigenetic modification.
23101626 Utf1 couples the core pluripotency factors with Myc and PRC2 networks to promote the pluripotency and proliferation of embryonic stem cells.
22880087 These findings strongly suggest that UTF1 promoter methylation profile might be a useful biomarker for cervical cancer diagnosis.
21446939 role for UTF1 in differentiation of matrix cells of the shaft as well as in suprabasal keratinocytes.
20855642 Strong UTF1 staining can be used for diagnosing embryonal carcinoma and seminoma. UTF1 expression in spermatogonia suggests its possible role in spermatogenesis and renewal of spermatogonia.
20218897 Single SNPs did not alter the chromatin association and mobility of hUTF1; however, the double mutant, G73R/L275M, demonstrated a decreased chromatin association, indicating a degree of protein malfunction.
19393592 Human UTF1 is a tightly DNA-associated protein with transcriptional repressor activity.
18983962 enhances reprogramming efficiency of pluripotent stem cells generation induced from human adult fibroblasts
18281244 The expression pattern indicated that UTF-1 plays a possible role in spermatogonial self-renewal

AA Sequence

MLLRPRRPPPLAPPAPPSPASPDPEPRTPGDAPGTPPRRPASPSALGELGLPVSPGSAQRTPWSARETEL      1 - 70
LLGTLLQPAVWRALLLDRRQALPTYRRVSAALAQQQVRRTPAQCRRRYKFLKDKFREAHGQPPGPFDEQI     71 - 140
RKLMGLLGDNGRKRPRRRSPGSGRPQRARRPVPNAHAPAPSEPDATPLPTARDRDADPTWTLRFSPSPPK    141 - 210
SADASPAPGSPPAPAPTALATCIPEDRAPVRGPGSPPPPPAREDPDSPPGRPEDCAPPPAAPPSLNTALL    211 - 280
QTLGHLGDIANILGPLRDQLLTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVLRDPCQ             281 - 341
//

Text Mined References (16)

PMID Year Title
24738751 2014 Expression profile of undifferentiated cell transcription factor 1 in normal and cancerous human epithelia.
24614704 2014 The embryonic stem cell factor UTF1 serves as a reliable diagnostic marker for germinomas.
23536577 2013 Undifferentiated embryonic cell transcription factor-1 (UTF1) inhibits the growth of cervical cancer cells by transactivating p27Kip1.
23101626 2012 Regulation of pluripotency and self- renewal of ESCs through epigenetic-threshold modulation and mRNA pruning.
22880087 2012 Aberrant promoter methylation and expression of UTF1 during cervical carcinogenesis.
22205530 2013 Use of UTF1 genetic control elements as iPSC reporter.
21446939 2011 Embryonic stem cell factors undifferentiated transcription factor-1 (UFT-1) and reduced expression protein-1 (REX-1) are widely expressed in human skin and may be involved in cutaneous differentiation but not in stem cell fate determination.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20855642 2010 Expression of UTF1 in primary and metastatic testicular germ cell tumors.
20218897 2010 Functional characterization of single-nucleotide polymorphisms in the human undifferentiated embryonic-cell transcription factor 1 gene.
More...