Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 5
Funding $440,189.99
PubMed Score 166.19
PubTator Score 35.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.918 0.000
atypical teratoid/rhabdoid tumor -1.300 0.001
sarcoidosis -1.200 0.000

 GWAS Trait (1)

Gene RIF (6)

PMID Text
22200884 Suggest that CTMP may therefore play a critical role in mitochondrial-mediated apoptosis in lung cancer cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19679565 Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4.
19604401 Phosphorylation on Ser37/Ser38 of CTMP is important for the prevention of mitochondrial localization of CTMP, eventually leading to cell death by binding to heat shock protein 70.
19168129 Proper maturation of CTMP is essential for its pro-apoptotic function. CTMP delays PKB phosphorylation following cell death induction, suggesting that CTMP regulates apoptosis via inhibition of PKB.
17615157 CTMP induces translocation of Akt to the membrane and thereby increases the level of Akt phosphorylation. As a result, CTMP enhances various cellular activities that are principally mediated by the PI3-kinase/Akt pathway.

AA Sequence

MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED      1 - 70
GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG     71 - 140
GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV    141 - 210
SCNVQSVDEKTLYSEATSLFIKLNPAKSLT                                            211 - 240
//

Text Mined References (23)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
22871024 2012 Correlation of structure and function in the human hotdog-fold enzyme hTHEM4.
22586271 2012 Acyl coenzyme A thioesterase Them5/Acot15 is involved in cardiolipin remodeling and fatty liver development.
22200884 2012 Carboxyl-terminal modulator protein induces apoptosis by regulating mitochondrial function in lung cancer cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19679565 2009 The DNA methylome of pediatric acute lymphoblastic leukemia.
19604401 2009 Heat shock protein 70-mediated sensitization of cells to apoptosis by Carboxyl-Terminal Modulator Protein.
19453107 2009 The Akt C-terminal modulator protein is an acyl-CoA thioesterase of the Hotdog-Fold family.
19421406 2009 The Carboxy-Terminal Modulator Protein (CTMP) regulates mitochondrial dynamics.
More...