Property Summary

NCBI Gene PubMed Count 20
PubMed Score 171.37
PubTator Score 35.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Disease Target Count
Liver carcinoma 240
Disease Target Count P-value
sarcoidosis 370 4.9e-05
osteosarcoma 7950 4.5e-03
atypical teratoid / rhabdoid tumor 5112 1.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-02
osteosarcoma -1.202 4.5e-03
sarcoidosis -1.200 4.9e-05

Protein-protein Interaction (13)

Gene RIF (6)

AA Sequence

MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCED      1 - 70
GSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQG     71 - 140
GPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFV    141 - 210
SCNVQSVDEKTLYSEATSLFIKLNPAKSLT                                            211 - 240
//

Text Mined References (26)

PMID Year Title