Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.20
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Leprosy 73 5.044 2.5
Polydactyly 107 3.089 1.5

Expression

Synonym

Accession Q5T0U0 B2RP70 B7ZMI9 Q96MV0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MSDNKERKSQGFPKEDNQDTSSLADAVEKVAKQQQSQASEIEKNKKVLFNLKNELHELEKEIAAISAETK      1 - 70
ETERQIYQQDSAIENTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHKNSLG     71 - 140
EVESKWSFMTELHEKRDFVKKLKTMKEELMQDLQNPGGNRITQVQEDITNLKDKIITVKESIIEKTCFLE    141 - 210
EEKKTHEKLRKEIEVQHKRYDAILKRLHCQVNKLQSNRRQWQWNIQQLEKTAAELRKCIGMQE           211 - 273
//

Text Mined References (13)

PMID Year Title