Property Summary

NCBI Gene PubMed Count 28
PubMed Score 46.88
PubTator Score 8.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Esophageal Neoplasms 69 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.4e-09
Breast cancer 3578 2.4e-06
osteosarcoma 7950 6.2e-05
dermatomyositis 966 6.1e-04
astrocytoma 1146 7.1e-03
mucosa-associated lymphoid tissue lymphoma 484 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0
Disease Target Count Z-score Confidence
Mastitis 48 3.258 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.700 7.1e-03
Breast cancer -1.200 2.4e-06
dermatomyositis 1.400 6.1e-04
mucosa-associated lymphoid tissue lympho... 1.127 1.2e-02
osteosarcoma -3.753 6.2e-05
ovarian cancer -2.200 1.4e-09

Gene RIF (19)

AA Sequence

MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT      1 - 70
SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR     71 - 140
KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG    141 - 210
GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTE    211 - 280
PEDTGAEIIHV                                                               281 - 291
//

Text Mined References (31)

PMID Year Title