Property Summary

NCBI Gene PubMed Count 24
Grant Count 174
R01 Count 47
Funding $47,294,698.03
PubMed Score 40.26
PubTator Score 8.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.753 0.000
astrocytoma 1.700 0.007
Breast cancer -1.200 0.000
mucosa-associated lymphoid tissue lympho... 1.127 0.012
ovarian cancer -2.200 0.000
dermatomyositis 1.400 0.001

Synonym

Accession Q5T0T0 B2R8E7 H0Y7C6 Q5T0S8 Q8TC72
Symbols MIR
CMIR
c-MIR
RNF178
MARCH-VIII

Gene

PANTHER Protein Class (2)

PDB

2D8S  

Gene RIF (13)

PMID Text
26523972 MARCH8 is highly expressed in terminally differentiated myeloid cells, and that it is a potent antiviral protein that targets viral envelope glycoproteins and reduces their incorporation into virions.
23606747 MARCH 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor.
23300075 endogenous MARCH-8 regulates the steady-state cell surface expression of TRAIL-R1.
23170932 Expression of MARCH-8 inhibits HLA-DR-mediated enhancement of mature Gag products internalization by downregulating cell surface HLA-DR
22904187 MARCH8-mediated polyubiquitination and degradation of IL1RAP is an important mechanism for negative regulation of IL-1beta-induced signaling pathways.
22082156 Knockdown of membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase (MARCH8) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21757542 MARCH8 expression led to direct ubiquitination of CD98 and routing of CD98 to late endosomes/lysosomes
21752829 MARCH8 protein localizes in lysosomes in HeLa cells
21151997 Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT      1 - 70
SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR     71 - 140
KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG    141 - 210
GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTE    211 - 280
PEDTGAEIIHV                                                               281 - 291
//

Text Mined References (27)

PMID Year Title
26523972 2015 MARCH8 inhibits HIV-1 infection by reducing virion incorporation of envelope glycoproteins.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23606747 2013 Membrane-associated RING-CH (MARCH) 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor.
23300075 2013 Ubiquitination by the membrane-associated RING-CH-8 (MARCH-8) ligase controls steady-state cell surface expression of tumor necrosis factor-related apoptosis inducing ligand (TRAIL) receptor 1.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22904187 2012 The E3 ubiquitin ligase MARCH8 negatively regulates IL-1?-induced NF-?B activation by targeting the IL1RAP coreceptor for ubiquitination and degradation.
21757542 2011 MARCH ubiquitin ligases alter the itinerary of clathrin-independent cargo from recycling to degradation.
More...