Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
R01 Count 2
Funding $128,638.67
PubMed Score 7.55
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.000
group 4 medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.700 0.000
non primary Sjogren syndrome sicca 1.300 0.018
ovarian cancer -1.200 0.000

AA Sequence

MAAAGEGTPSSRGPRRDPPRRPPRNGYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGE      1 - 70
ITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNK     71 - 140
RHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKGQWHSDVFSGLGSMAHCSGVTYYGLWINGHP    141 - 210
AEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRD    211 - 280
NQETLIQTPFGFECIPYPVSSPAAGVPGPRAAKGGAEADVPLPRGDLELHLGALHGQEDTPGGLLARGHA    281 - 350
PHCPGACQRVEQGCAEFTDVLLGPPPPGYHPFLFLDSLHKKAGGRSRGGLHPRGTPPTAQEPPGGSRPEG    351 - 420
RATEEQAAAAHLGEYVLMIRDVTTPPFLGRRLPPAFKHLRVVAKRAGQPPHVLEEGPEASSSWQAAHSCT    421 - 490
PEPPAPR                                                                   491 - 497
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.