Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.4e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 5.4e-03

Gene RIF (1)

AA Sequence

MPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNI      1 - 70
PHEGKHTPLYERSLPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATKYTIYWGFRATDHHVQGRD     71 - 140
SQARGTAAHWHGGHVCSPNVFWRISHGPAQQLTFPTEQAAPPVCPAPASRRLSAPG                  141 - 196
//

Text Mined References (2)

PMID Year Title