Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.005

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNI      1 - 70
PHEGKHTPLYERSLPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATKYTIYWGFRATDHHVQGRD     71 - 140
SQARGTAAHWHGGHVCSPNVFWRISHGPAQQLTFPTEQAAPPVCPAPASRRLSAPG                  141 - 196
//

Text Mined References (2)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15164053 2004 DNA sequence and analysis of human chromosome 9.