Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5SY85
Symbols C9orf122

Gene

 Compartment GO Term (1)

AA Sequence

MGLRAGSRCRADHLAQPQPQGHLAPVLRCGECWRARGLPGGCCLHTEGGCSLGAQAGWRTAGWEARGRRD      1 - 70
LGLETTSAHSRSLLHLSSWRRPDVGEAAGAELLQRAPLQQPDPAQAAVEGGLLARLPRPQDQGCGQHRPH     71 - 140
SPRLVDIALPGGGWT                                                           141 - 155
//

Text Mined References (3)

PMID Year Title
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.