Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 4.8e-02
Astrocytoma, Pilocytic -1.300 7.3e-06
group 3 medulloblastoma -1.500 1.1e-03
medulloblastoma, large-cell -1.400 1.8e-03
non primary Sjogren syndrome sicca -1.100 2.7e-02
osteosarcoma -1.722 3.4e-05
psoriasis -2.200 9.0e-77

Synonym

Accession Q5SY85
Symbols C9orf122

Gene

 Compartment GO Term (1)

AA Sequence

MGLRAGSRCRADHLAQPQPQGHLAPVLRCGECWRARGLPGGCCLHTEGGCSLGAQAGWRTAGWEARGRRD      1 - 70
LGLETTSAHSRSLLHLSSWRRPDVGEAAGAELLQRAPLQQPDPAQAAVEGGLLARLPRPQDQGCGQHRPH     71 - 140
SPRLVDIALPGGGWT                                                           141 - 155
//

Text Mined References (3)

PMID Year Title