Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.91
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYS      1 - 70
GIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNT     71 - 140
IQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTC    141 - 210
GLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFF    211 - 280
VTYEQLKKLDL                                                               281 - 291
//

Text Mined References (9)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15809292 2005 A new renal mitochondrial carrier, KMCP1, is up-regulated during tubular cell regeneration and induction of antioxidant enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.