Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.91
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy -2.036 1.1e-05
astrocytic glioma -1.200 3.5e-02
Breast cancer -2.600 2.8e-02
Duchenne muscular dystrophy -1.123 2.5e-04
limb girdle muscular dystrophy 2B -1.005 7.1e-03
non diabetic and post-ischemic heart fai... 1.100 1.6e-02
oligodendroglioma -1.400 2.6e-02
osteosarcoma -2.110 1.6e-06
pancreatic ductal adenocarcinoma liver m... -2.059 4.4e-04

Gene RIF (2)

AA Sequence

MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYS      1 - 70
GIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNT     71 - 140
IQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTC    141 - 210
GLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFF    211 - 280
VTYEQLKKLDL                                                               281 - 291
//

Text Mined References (10)

PMID Year Title