Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $460,281.9
PubMed Score 23.47
PubTator Score 88.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
24967714 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
24473444 MANEA plays a role in anxiety disorders.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19255376 Association of variants in MANEA with cocaine related behavior is established.
19255376 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18438686 Observational study of gene-disease association. (HuGE Navigator)
15677381 We have cloned two novel endomannosidase sequences from rat and human cDNA libraries [and] confirm that endomannosidase is a type II membrane protein, like the majority of other secretory pathway glycosylation enzymes
12560567 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
11530211 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
9109416 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MAKFRRRTCIILALFILFIFSLMMGLKMLRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSE      1 - 70
TNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYP     71 - 140
QGRHNPPDDIGSSFYPELGSYSSRDPSVIETHMRQMRSASIGVLALSWYPPDVNDENGEPTDNLVPTILD    141 - 210
KAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWAN    211 - 280
LLTTSGSRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIYTYFATNGFTYGSSHQNWASLKLFCDKYNL    281 - 350
IFIPSVGPGYIDTSIRPWNTQNTRNRINGKYYEIGLSAALQTRPSLISITSFNEWHEGTQIEKAVPKRTS    351 - 420
NTVYLDYRPHKPGLYLELTRKWSEKYSKERATYALDRQLPVS                                421 - 462
//

Text Mined References (18)

PMID Year Title
24473444 2014 The ?-endomannosidase gene (MANEA) is associated with panic disorder and social anxiety disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19255376 2009 Association of variants in MANEA with cocaine-related behaviors.
18438686 2008 Substance dependence low-density whole genome association study in two distinct American populations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15760709 2005 Human endo-alpha1,2-mannosidase is a Golgi-resident type II membrane protein.
15677381 2005 Intact {alpha}-1,2-endomannosidase is a typical type II membrane protein.
More...