Property Summary

NCBI Gene PubMed Count 15
PubMed Score 24.58
PubTator Score 88.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.200 1.8e-03
Astrocytoma, Pilocytic 1.600 4.5e-06
atypical teratoid / rhabdoid tumor 1.200 6.8e-07
ependymoma 1.800 9.2e-10
gastric cancer 1.200 2.2e-03
glioblastoma 1.400 2.3e-06
hepatocellular carcinoma 1.500 3.8e-05
lung cancer 1.700 2.9e-03
medulloblastoma 1.300 3.4e-05
medulloblastoma, large-cell 1.200 4.2e-04
nasopharyngeal carcinoma 1.300 6.1e-05
non primary Sjogren syndrome sicca -1.100 2.4e-02
ovarian cancer -1.200 2.8e-03
pancreatic cancer 1.700 2.7e-02
pancreatic carcinoma 1.700 2.7e-02
pancreatic ductal adenocarcinoma liver m... -3.770 3.1e-04
pituitary cancer 1.500 4.6e-05
primitive neuroectodermal tumor 1.300 1.0e-04
sarcoidosis 1.100 1.8e-02
ulcerative colitis 1.500 1.6e-03

Gene RIF (20)

AA Sequence

MAKFRRRTCIILALFILFIFSLMMGLKMLRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSE      1 - 70
TNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYP     71 - 140
QGRHNPPDDIGSSFYPELGSYSSRDPSVIETHMRQMRSASIGVLALSWYPPDVNDENGEPTDNLVPTILD    141 - 210
KAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWAN    211 - 280
LLTTSGSRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIYTYFATNGFTYGSSHQNWASLKLFCDKYNL    281 - 350
IFIPSVGPGYIDTSIRPWNTQNTRNRINGKYYEIGLSAALQTRPSLISITSFNEWHEGTQIEKAVPKRTS    351 - 420
NTVYLDYRPHKPGLYLELTRKWSEKYSKERATYALDRQLPVS                                421 - 462
//

Text Mined References (18)

PMID Year Title