Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYF      1 - 70
LSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQS     71 - 140
MYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSA    141 - 210
PGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQP    211 - 280
TAELPFPQLYT                                                               281 - 291
//

Text Mined References (11)

PMID Year Title