Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.58
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 1.7e-06
ovarian cancer 8520 1.5e-03
acute myeloid leukemia 783 5.0e-02
Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 0.9
Rheumatoid arthritis 1191 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -2.200 5.0e-02
ovarian cancer 1.800 1.5e-03
pituitary cancer 1.100 1.7e-06

Gene RIF (1)

AA Sequence

MSVEPPPELEEKAASEPEAGAMPEKRAGAQAAGSTWLQGFGRPSVYHAAIVIFLEFFAWGLLTTPMLTVL      1 - 70
HETFSQHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFTCFPIPLMRISPWWYFAMISV     71 - 140
SGVFSVTFSVIFAYVADVTQEHERSTAYGWVSATFAASLVSSPAIGAYLSASYGDSLVVLVATVVALLDI    141 - 210
CFILVAVPESLPEKMRPVSWGAQISWKQADPFASLKKVGKDSTVLLICITVFLSYLPEAGQYSSFFLYLR    211 - 280
QVIGFGSVKIAAFIAMVGILSIVAQTAFLSILMRSLGNKNTVLLGLGFQMLQLAWYGFGSQAWMMWAAGT    281 - 350
VAAMSSITFPAISALVSRNAESDQQGVAQGIITGIRGLCNGLGPALYGFIFYMFHVELTELGPKLNSNNV    351 - 420
PLQGAVIPGPPFLFGACIVLMSFLVALFIPEYSKASGVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSI    421 - 490
WELSSFEEPGNQCTEL                                                          491 - 506
//

Text Mined References (7)

PMID Year Title