Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Corneal disease 32 2.0
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.042

Synonym

Accession Q5SQ13
Symbols C9orf141

Gene

 Compartment GO Term (0)

AA Sequence

MLGTQWTLARCLLPSHPDPGLAGSLRGDSSEDGRRGQLLPQSPAPCSPVWSPGTPVGGPHPAGDGPATAP      1 - 70
GPPEGPELAFPQDLSPAWPQKGAGTHPANAGPGPLSRRSSQLRTPLEAGRKWGWKMTRWRLRRDQAPGEG     71 - 140
TQAKLLGEALSTAGRGHAGPPEGWAGEGGVSPGLTPLLGTGQGKELDLDLREKFIRFDQILGISLDHIPF    141 - 210
LPQTGPGRPWGCGVGKQRPH                                                      211 - 230
//

Text Mined References (2)

PMID Year Title
23328707 2013 Genome-wide significant locus of beta-trace protein, a novel kidney function biomarker, identified in European and African Americans.
15164053 2004 DNA sequence and analysis of human chromosome 9.