Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.2e-02
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.2e-02

Synonym

Accession Q5SQ13
Symbols C9orf141

Gene

 Compartment GO Term (0)

AA Sequence

MLGTQWTLARCLLPSHPDPGLAGSLRGDSSEDGRRGQLLPQSPAPCSPVWSPGTPVGGPHPAGDGPATAP      1 - 70
GPPEGPELAFPQDLSPAWPQKGAGTHPANAGPGPLSRRSSQLRTPLEAGRKWGWKMTRWRLRRDQAPGEG     71 - 140
TQAKLLGEALSTAGRGHAGPPEGWAGEGGVSPGLTPLLGTGQGKELDLDLREKFIRFDQILGISLDHIPF    141 - 210
LPQTGPGRPWGCGVGKQRPH                                                      211 - 230
//

Text Mined References (2)

PMID Year Title