Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung adenocarcinoma 2,713

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.300 0.000

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTRMSCPWGSYQWEPGACPAAPRGIGGGDMAGGIPDVRGLQEAALGAGRSQEEARLVEEAQTPVMLPQDS      1 - 70
GQRVEEVPGDLMAKRMSLILHVQKLPWDHVPCLRRTRQNLYQDVGGHAHGSGLGGAKRGAARSALRRPLP     71 - 140
PATCRPAGIVSGPSPRLDSNPTGAHLIKQTRPLTVEWTKDTPVPEPMELRSDASHKENVSPKPAALPKPG    141 - 210
KRLKQRRFRRSLGIGLSGRHDQWVPGCQVERGGPAATPSPGAVLDQEPCRVQTNLASPGPRLGLALKDTT    211 - 280
GQLVNSSFWQQSNLQSLARRRQGKAREFAIQQSNLSINETSSPHLCPEPGGSSGPHKLPWGPLLSQEPLA    281 - 350
RPSSCLRQSGLPAPGTPSGDFRPTEAFAPLDGHTQPGLRSWGGLGSWRSRLVGEPLTLEDLAVPSQNQTQ    351 - 420
APSRAAVHQLLASVHCLAQEAARLRCQAPQEPPAWGVSPKQKGEEGAPRERVHREEERTAFHLSDTVPAS    421 - 490
SASKNKAQNITAPESEAICWQLLSRCFRSWRHLVKRQREPAAAAVALGRWQLLRKCLQALWLREAQLEAA    491 - 560
WGQYTKVLLVRSFREVSGLQVGPGGRVKQCPGSLREEEIAQRLLSHPRQRTDSRHERVQILQALQLAVFF    561 - 630
LWCQQKKRARQERETLRKATRATQRTGSFPQAWHSTAAGVAWVAPLSPQHQRAWLCRCFGAWQQFVQRGS    631 - 700
RYRDHLADRRTGTLRKCLEQWVRMKQLRESDGAKVTQLSLCRQKAGREAVYTAGPGACGLGAVGQAQGQQ    701 - 770
EQGRGSLQDACWTLALCWALLLWKMRLFQRQWANSFFQGLQQRMLQRSLRWWHLRALGPDATSSCTKTPS    771 - 840
ALEPLSSSTLQDSLEKVPRAPTLPDTLQGSLLWAAGQRQQGQCLLLWQARAQQFQGTARWYQHTRQRRIF    841 - 910
LSWSRWATAQWAWRELASHRAWDRTCRAVLGLWRQRLLQSRLVEWWAQERGWRLARDALCHWHSCWQGQQ    911 - 980
FLHEKCQTWVQVHLQGLQKVVFRSWQQAAAHQRCTVTRPEQLLLQSYFQAWCEVVRDTGVLRAQHQAFQD    981 - 1050
GLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQKKARAPQAFPAWPVAPGMHH   1051 - 1120
EAQQQAGESAGAQAAQCWTWCWALWVHESCRGQVSRAHASWKPRAWVLEASVQSAVRGGVQRAILTQLRP   1121 - 1190
AELRRFLRTVQLRVRLGLPGAGKTRSCWTQATELVPPAPSLQCSLGGRRKPRGTAWAQRCREHSLCPAFQ   1191 - 1260
LWPQWPGQSSWVPGLPLWTRDQGPRAHSSPEPRACKAQSKAHKRRLRILEKQAQAHGSALLLALKGHDAL   1261 - 1330
GHQEEVPAAPVPRGTASRAAGFPAGQVPGSGMAALGGCPRGRAAGADPAQGVAPEMGLADVVAADPATAS   1331 - 1400
GSAVTAAGRWAFKKWHQRLAARSPRRGAASSPRPWSKPGPKGPESGQEAARAPRGWGLGAEHGAQLQL     1401 - 1468
//

Text Mined References (9)

PMID Year Title
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370778 2002 Multiple transcription start sites and alternative splicing in the methylenetetrahydrofolate reductase gene result in two enzyme isoforms.