Property Summary

NCBI Gene PubMed Count 13
Grant Count 7
R01 Count 4
Funding $445,432.87
PubMed Score 5.01
PubTator Score 25.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.004
astrocytic glioma -1.600 0.045
osteosarcoma 1.754 0.000
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.000
X-linked cerebral adrenoleukodystrophy 1.100 0.033
group 4 medulloblastoma 1.300 0.001
subependymal giant cell astrocytoma -1.095 0.050
ovarian cancer -1.100 0.000

 GO Function (1)

Gene RIF (2)

PMID Text
18289715 We have recently identified increased expression of p11 genes that implicate fibrinolysis in ALD progression.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.

AA Sequence

MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPR      1 - 70
QAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYP     71 - 140
RAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAG    141 - 210
LTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP            211 - 272
//

Text Mined References (16)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21255825 2011 The RNA exosome targets the AID cytidine deaminase to both strands of transcribed duplex DNA substrates.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
18289715 2008 Direct effects of alcohol on hepatic fibrinolytic balance: implications for alcoholic liver disease.
17174896 2006 Reconstitution, activities, and structure of the eukaryotic RNA exosome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...