Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.0e-06
Astrocytoma, Pilocytic 3081 4.3e-06
atypical teratoid / rhabdoid tumor 5112 1.5e-04
psoriasis 6694 6.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 4.3e-06
atypical teratoid / rhabdoid tumor 1.100 1.5e-04
osteosarcoma -1.515 3.0e-06
psoriasis -1.700 6.8e-04

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MAAASPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAADPTFVMGHAM      1 - 70
ATGLVLIGTGSSVKLDKELDLAVKTMVEISRTQPLTRREQLHVSAVETFANGNFPKACELWEQILQDHPT     71 - 140
DMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSSYVKGIYSFGLMETNFYDQAEKLAKEALSIN    141 - 210
PTDAWSVHTVAHIHEMKAEIKDGLEFMQHSETFWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDTHIL    211 - 280
PSLQANDAMLDVVDSCSMLYRLQMEGVSVGQRWQDVLPVARKHSRDHILLFNDAHFLMASLGAHDPQTTQ    281 - 350
ELLTTLRDASESPGENCQHLLARDVGLPLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQ    351 - 420
LLIHAALNCTSSVHKNVARSLLMERDALKPNSPLTERLIRKAATVHLMQ                         421 - 469
//

Text Mined References (11)

PMID Year Title