Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.80
PubTator Score 3.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Parathyroid carcinoma 7 4.154 2.1

Gene RIF (1)

AA Sequence

MCTSLTTCEWKKVFYEKMEVAKPADSWELIIDPNLKPSELAPGWKQYLEQHASGRFHCSWCWHTWQSAHV      1 - 70
VILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYEEDGGQYRIH     71 - 140
VASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNFLSLRWCLFWASLCL    141 - 210
LVVYLQFSFLSPAFF                                                           211 - 225
//

Text Mined References (9)

PMID Year Title