Property Summary

NCBI Gene PubMed Count 5
PubMed Score 57.03
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 7.5e-03
aldosterone-producing adenoma -1.032 2.9e-02
atypical teratoid / rhabdoid tumor -1.400 1.7e-06
ependymoma -1.100 2.1e-07
glioblastoma -1.500 2.7e-05
medulloblastoma -1.200 6.0e-03
medulloblastoma, large-cell -1.900 3.1e-05
osteosarcoma 1.181 3.4e-02
pituitary cancer 1.200 2.1e-07

 GO Component (1)

AA Sequence

MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEK      1 - 70
QFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQ     71 - 140
ASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPY    141 - 210
IVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKD    211 - 280
ECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS                               281 - 323
//

Text Mined References (12)

PMID Year Title