Property Summary

NCBI Gene PubMed Count 5
PubMed Score 52.70
PubTator Score 1.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.181 0.034
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.000
sonic hedgehog group medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.900 0.000
adult high grade glioma -1.300 0.008
aldosterone-producing adenoma -1.032 0.029
pituitary cancer 1.200 0.000

Synonym

Accession Q5PSV4 A6NFW5 A6NH45 B2RD65 Q9BRI4
Symbols BRMS1

Gene

 GO Function (1)

 GO Component (1)

AA Sequence

MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEK      1 - 70
QFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQ     71 - 140
ASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPY    141 - 210
IVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKD    211 - 280
ECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS                               281 - 323
//

Text Mined References (11)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...