Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5NE16
Symbols CTSL3
HCTSL-s

Gene

PANTHER Protein Class (3)

 Compartment GO Term (0)

AA Sequence

MKMIEQHNQEYREGKHSFTMAMNAFGEMTSEEFRQVVNGFQNQKHRKGKVLQEPLLHDIRKSVDWREKGY      1 - 70
VTPVKDQCNWGSVRTDVRKTEKLVSLSVQTWWTALGFKAMLAAFLENHYFASSMLPTMEAWTLRKPFHMK     71 - 140
KSSGDWKVQGHRGASGESLLASGESQQSPEVAQYSGKHQVQCHLIEEALQMLSGGDEDHDEDKWPHDMRN    141 - 210
HLAGEAQV                                                                  211 - 218
//

Text Mined References (2)

PMID Year Title
19663681 2009 CA/C1 peptidases of the malaria parasites Plasmodium falciparum and P. berghei and their mammalian hosts--a bioinformatical analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.