Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5NE16
Symbols CTSL3
HCTSL-s

Gene

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MKMIEQHNQEYREGKHSFTMAMNAFGEMTSEEFRQVVNGFQNQKHRKGKVLQEPLLHDIRKSVDWREKGY      1 - 70
VTPVKDQCNWGSVRTDVRKTEKLVSLSVQTWWTALGFKAMLAAFLENHYFASSMLPTMEAWTLRKPFHMK     71 - 140
KSSGDWKVQGHRGASGESLLASGESQQSPEVAQYSGKHQVQCHLIEEALQMLSGGDEDHDEDKWPHDMRN    141 - 210
HLAGEAQV                                                                  211 - 218
//

Text Mined References (2)

PMID Year Title