Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.95
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Papillary renal cell carcinoma 9 3.764 1.9
Multiple system atrophy 29 3.309 1.7

Gene RIF (1)

AA Sequence

MASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEIFQIILKYLSVKDISMLSMV      1 - 70
SKTVSQHIINYISTSSGSKRLLLQDFHNLELPDRRQDSAILEHYRSLGLLFKRCTLLLPTKERLKYIHKI     71 - 140
LTEVSCFKFNGCAAPMQCLGLTCYGMFLQTLTAGWDELECHRVYNFLCELTNLCRKIQMAVCSKPGSAQK    141 - 210
LELRIRLFCRNVLLDHWTHRSDSAFWLTRILKPWPMVNQARLLYIIFGPISPQDGQVVWQEMIEEPTDEF    211 - 280
SLKGLADAIKLLYDASTKEWTADDVISLVDELSVVPREWLLENNARLLMLSGNNICFSFMASKAVNGRTI    281 - 350
ELARLVVFLALVCEKELYCMDWTVKMMQKVCKVFSTPVERKNFLQNVANAFACVIMEMLQSIMSGDRDED    351 - 420
DRSFLNLFHLVHAQANFHKEVLYLTMNTPLST                                          421 - 452
//

Text Mined References (6)

PMID Year Title