Property Summary

NCBI Gene PubMed Count 22
PubMed Score 42.84
PubTator Score 24.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

AA Sequence

MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQD      1 - 70
MTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEET     71 - 140
KYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNY    141 - 210
NRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYT    211 - 280
GSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE                                         281 - 313
//

Text Mined References (22)

PMID Year Title