Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 1
Funding $671,206
PubMed Score 37.82
PubTator Score 24.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26644004 Spy1 participates in the proliferation and apoptosis of epithelial ovarian cancer.
26017671 A novel Spy1-CLIPR-59 interplay was identified in glioblastoma resistance to TNF-alpha.
25526860 CRMP1 interacted with Spy1 which would disturb the association of CRMP1 with actin and was involved in the collapse of growth cones induced by Sema3A and regeneration after sciatic nerve crush.
24434210 we demonstrate that the atypical cyclin-like protein Spy1 plays a role in balancing the division properties of glioma cells with stemness properties
24037419 Cell adhesion to fibronectin down-regulates the expression of Spy1 and contributes to drug resistance in multiple myeloma cells.
22492278 Our results suggest that Spy1 may be a possible prognostic indicator in NHLs, and it was correlated with phosphorylation of p27(Kip1) on Thr187
22447439 Spy1 expression positively correlates with the malignancy of gliomas.
19686732 Spy1 overexpression is involved in the pathogenesis of hepatocellular carcinoma, it may be a favorable independent poor prognostic parameter for hepatocellular carcinoma.
19622356 Data show that tight regulation of RINGO/Speedy A is important for the somatic cell cycle.
19106603 Spy1 fulfills a novel regulatory role in the intrinsic DNA damage response and maintains the balance between checkpoint activation, apoptosis, repair and cell cycle progression in response to exogenous or intrinsic damage.
More...

AA Sequence

MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQD      1 - 70
MTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEET     71 - 140
KYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNY    141 - 210
NRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYT    211 - 280
GSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE                                         281 - 313
//

Text Mined References (20)

PMID Year Title
26644004 2016 Spy1 participates in the proliferation and apoptosis of epithelial ovarian cancer.
26017671 2015 Spy1 induces de-ubiquitinating of RIP1 arrest and confers glioblastoma's resistance to tumor necrosis factor (TNF-?)-induced apoptosis through suppressing the association of CLIPR-59 and CYLD.
25526860 2016 CRMP1 Interacted with Spy1 During the Collapse of Growth Cones Induced by Sema3A and Acted on Regeneration After Sciatic Nerve Crush.
24434210 2014 The cyclin-like protein Spy1 regulates growth and division characteristics of the CD133+ population in human glioma.
24037419 2013 Cell adhesion to fibronectin down-regulates the expression of Spy1 and contributes to drug resistance in multiple myeloma cells.
22492278 2012 Expression of Spy1 protein in human non-Hodgkin's lymphomas is correlated with phosphorylation of p27 Kip1 on Thr187 and cell proliferation.
22447439 2012 Spy1 is frequently overexpressed in malignant gliomas and critically regulates the proliferation of glioma cells.
19686732 2009 Expression and prognostic role of Spy1 as a novel cell cycle protein in hepatocellular carcinoma.
19622356 2009 Cell cycle regulation of the mammalian CDK activator RINGO/Speedy A.
19106603 2009 The atypical CDK activator Spy1 regulates the intrinsic DNA damage response and is dependent upon p53 to inhibit apoptosis.
More...